Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   MF598_RS18210 Genome accession   NZ_CP092185
Coordinates   3648991..3649110 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain K203     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3643991..3654110
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MF598_RS18185 (MF598_18185) - 3644226..3644984 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  MF598_RS18190 (MF598_18190) - 3644978..3645925 (-) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  MF598_RS18195 (MF598_18195) ceuB 3645915..3646868 (-) 954 WP_032872883.1 ABC transporter permease Machinery gene
  MF598_RS18200 (MF598_18200) - 3647282..3648646 (+) 1365 WP_007609394.1 aspartate kinase -
  MF598_RS18205 (MF598_18205) - 3648741..3648842 (+) 102 WP_239033885.1 YjcZ family sporulation protein -
  MF598_RS18210 (MF598_18210) phrC 3648991..3649110 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  MF598_RS18215 (MF598_18215) rapC 3649094..3650242 (-) 1149 WP_029326229.1 Rap family tetratricopeptide repeat protein Regulator
  MF598_RS18220 (MF598_18220) - 3650401..3651828 (-) 1428 WP_224224030.1 HAMP domain-containing sensor histidine kinase -
  MF598_RS18225 (MF598_18225) - 3651815..3652498 (-) 684 WP_007609386.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=656282 MF598_RS18210 WP_003156334.1 3648991..3649110(-) (phrC) [Bacillus velezensis strain K203]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=656282 MF598_RS18210 WP_003156334.1 3648991..3649110(-) (phrC) [Bacillus velezensis strain K203]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718