Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   LGL65_RS15485 Genome accession   NZ_CP092110
Coordinates   3018977..3019117 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain LOH112     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3013977..3024117
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LGL65_RS15460 - 3014281..3014679 (+) 399 WP_003152031.1 DUF1694 domain-containing protein -
  LGL65_RS15465 - 3014776..3015327 (+) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  LGL65_RS15470 - 3015345..3016811 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  LGL65_RS15475 - 3016941..3018164 (+) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  LGL65_RS15480 - 3018171..3018512 (-) 342 WP_014418765.1 hypothetical protein -
  LGL65_RS15485 degQ 3018977..3019117 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  LGL65_RS15490 - 3019248..3020144 (+) 897 WP_017419425.1 polyprenyl synthetase family protein -
  LGL65_RS15495 comX 3020159..3020335 (+) 177 WP_017419424.1 competence pheromone ComX -
  LGL65_RS15500 comP 3020354..3022660 (+) 2307 WP_017419423.1 sensor histidine kinase Regulator
  LGL65_RS15505 comA 3022741..3023385 (+) 645 WP_014418762.1 response regulator transcription factor Regulator
  LGL65_RS15510 - 3023407..3023790 (+) 384 WP_017419422.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=655975 LGL65_RS15485 WP_003152043.1 3018977..3019117(+) (degQ) [Bacillus velezensis strain LOH112]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=655975 LGL65_RS15485 WP_003152043.1 3018977..3019117(+) (degQ) [Bacillus velezensis strain LOH112]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891