Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   L6503_RS04525 Genome accession   NZ_CP091770
Coordinates   962189..962314 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain K115     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 957189..967314
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L6503_RS04505 (L6503_04505) - 957879..959291 (-) 1413 WP_237775352.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  L6503_RS04510 (L6503_04510) comB10 959361..960491 (-) 1131 WP_237775353.1 DNA type IV secretion system protein ComB10 Machinery gene
  L6503_RS04515 (L6503_04515) comB9 960484..961449 (-) 966 WP_237775354.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  L6503_RS04520 (L6503_04520) comB8 961449..962192 (-) 744 WP_237775355.1 type IV secretion system protein Machinery gene
  L6503_RS04525 (L6503_04525) comB7 962189..962314 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  L6503_RS04530 (L6503_04530) comB6 962330..963385 (-) 1056 WP_126131604.1 P-type conjugative transfer protein TrbL Machinery gene
  L6503_RS04535 (L6503_04535) - 963393..964388 (-) 996 WP_121292642.1 PDZ domain-containing protein -
  L6503_RS04540 (L6503_04540) - 964388..964681 (-) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  L6503_RS04545 (L6503_04545) panD 964692..965042 (-) 351 WP_154469994.1 aspartate 1-decarboxylase -
  L6503_RS04550 (L6503_04550) - 965032..967254 (-) 2223 WP_237775356.1 AAA family ATPase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=653528 L6503_RS04525 WP_001217874.1 962189..962314(-) (comB7) [Helicobacter pylori strain K115]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=653528 L6503_RS04525 WP_001217874.1 962189..962314(-) (comB7) [Helicobacter pylori strain K115]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878