Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   L3V45_RS12060 Genome accession   NZ_CP091421
Coordinates   2482908..2483285 (-) Length   125 a.a.
NCBI ID   WP_003153092.1    Uniprot ID   -
Organism   Bacillus sp. R45     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2477908..2488285
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L3V45_RS12020 (L3V45_12020) - 2478407..2479201 (+) 795 WP_014305407.1 YqhG family protein -
  L3V45_RS12025 (L3V45_12025) sinI 2479378..2479551 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  L3V45_RS12030 (L3V45_12030) sinR 2479585..2479920 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  L3V45_RS12035 (L3V45_12035) - 2479968..2480753 (-) 786 WP_236837015.1 TasA family protein -
  L3V45_RS12040 (L3V45_12040) - 2480817..2481401 (-) 585 WP_012117977.1 signal peptidase I -
  L3V45_RS12045 (L3V45_12045) tapA 2481373..2482044 (-) 672 WP_234949395.1 amyloid fiber anchoring/assembly protein TapA -
  L3V45_RS12050 (L3V45_12050) - 2482303..2482632 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  L3V45_RS12055 (L3V45_12055) - 2482672..2482851 (-) 180 WP_003153093.1 YqzE family protein -
  L3V45_RS12060 (L3V45_12060) comGG 2482908..2483285 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  L3V45_RS12065 (L3V45_12065) comGF 2483286..2483681 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  L3V45_RS12070 (L3V45_12070) comGE 2483695..2484009 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  L3V45_RS12075 (L3V45_12075) comGD 2483993..2484430 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  L3V45_RS12080 (L3V45_12080) comGC 2484420..2484728 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  L3V45_RS12085 (L3V45_12085) comGB 2484733..2485770 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  L3V45_RS12090 (L3V45_12090) comGA 2485757..2486827 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  L3V45_RS12095 (L3V45_12095) - 2487026..2487976 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14169.15 Da        Isoelectric Point: 10.1579

>NTDB_id=650944 L3V45_RS12060 WP_003153092.1 2482908..2483285(-) (comGG) [Bacillus sp. R45]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSNRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=650944 L3V45_RS12060 WP_003153092.1 2482908..2483285(-) (comGG) [Bacillus sp. R45]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTAATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512