Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   L3V45_RS12025 Genome accession   NZ_CP091421
Coordinates   2479378..2479551 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus sp. R45     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2474378..2484551
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L3V45_RS12010 (L3V45_12010) gcvT 2475195..2476295 (-) 1101 WP_095315606.1 glycine cleavage system aminomethyltransferase GcvT -
  L3V45_RS12015 (L3V45_12015) - 2476719..2478389 (+) 1671 WP_003153107.1 SNF2-related protein -
  L3V45_RS12020 (L3V45_12020) - 2478407..2479201 (+) 795 WP_014305407.1 YqhG family protein -
  L3V45_RS12025 (L3V45_12025) sinI 2479378..2479551 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  L3V45_RS12030 (L3V45_12030) sinR 2479585..2479920 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  L3V45_RS12035 (L3V45_12035) - 2479968..2480753 (-) 786 WP_236837015.1 TasA family protein -
  L3V45_RS12040 (L3V45_12040) - 2480817..2481401 (-) 585 WP_012117977.1 signal peptidase I -
  L3V45_RS12045 (L3V45_12045) tapA 2481373..2482044 (-) 672 WP_234949395.1 amyloid fiber anchoring/assembly protein TapA -
  L3V45_RS12050 (L3V45_12050) - 2482303..2482632 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  L3V45_RS12055 (L3V45_12055) - 2482672..2482851 (-) 180 WP_003153093.1 YqzE family protein -
  L3V45_RS12060 (L3V45_12060) comGG 2482908..2483285 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  L3V45_RS12065 (L3V45_12065) comGF 2483286..2483681 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  L3V45_RS12070 (L3V45_12070) comGE 2483695..2484009 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  L3V45_RS12075 (L3V45_12075) comGD 2483993..2484430 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=650942 L3V45_RS12025 WP_003153105.1 2479378..2479551(+) (sinI) [Bacillus sp. R45]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=650942 L3V45_RS12025 WP_003153105.1 2479378..2479551(+) (sinI) [Bacillus sp. R45]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702