Detailed information    

insolico Bioinformatically predicted

Overview

Name   crp   Type   Regulator
Locus tag   L2Z42_RS06930 Genome accession   NZ_CP091335
Coordinates   1401130..1401837 (+) Length   235 a.a.
NCBI ID   WP_000203217.1    Uniprot ID   -
Organism   Acinetobacter baumannii strain ATCC17978-VUB     
Function   regulate competence development (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1398947..1455873 1401130..1401837 within 0


Gene organization within MGE regions


Location: 1398947..1455873
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L2Z42_RS06910 (L2Z42_06910) - 1398947..1399753 (+) 807 WP_001237343.1 peptidoglycan DD-metalloendopeptidase family protein -
  L2Z42_RS06915 (L2Z42_06915) - 1399750..1400175 (-) 426 WP_001026231.1 GNAT family N-acetyltransferase -
  L2Z42_RS06920 (L2Z42_06920) - 1400269..1400691 (-) 423 WP_001195082.1 OsmC family protein -
  L2Z42_RS06925 (L2Z42_06925) - 1400770..1400889 (-) 120 Protein_1367 hypothetical protein -
  L2Z42_RS06930 (L2Z42_06930) crp 1401130..1401837 (+) 708 WP_000203217.1 cAMP-activated global transcriptional regulator CRP Regulator
  L2Z42_RS06935 (L2Z42_06935) - 1401998..1403047 (+) 1050 WP_001159807.1 NADP(H)-dependent aldo-keto reductase -
  L2Z42_RS06940 (L2Z42_06940) - 1403107..1403886 (-) 780 WP_001034598.1 M48 family metallopeptidase -
  L2Z42_RS06945 (L2Z42_06945) - 1404003..1404320 (-) 318 WP_000776215.1 hypothetical protein -
  L2Z42_RS06950 (L2Z42_06950) - 1404443..1405762 (-) 1320 WP_000517792.1 adenylosuccinate synthase -
  L2Z42_RS06955 (L2Z42_06955) - 1405827..1406993 (-) 1167 WP_000155682.1 ATP phosphoribosyltransferase regulatory subunit -
  L2Z42_RS06960 (L2Z42_06960) - 1407269..1408294 (-) 1026 WP_001188821.1 type I glyceraldehyde-3-phosphate dehydrogenase -
  L2Z42_RS06965 (L2Z42_06965) alaS 1408564..1411200 (+) 2637 WP_000199457.1 alanine--tRNA ligase -
  L2Z42_RS06970 (L2Z42_06970) - 1411487..1412692 (+) 1206 WP_001229156.1 site-specific integrase -
  L2Z42_RS06975 (L2Z42_06975) - 1412785..1413768 (-) 984 WP_001008609.1 hypothetical protein -
  L2Z42_RS06980 (L2Z42_06980) - 1413773..1414285 (-) 513 WP_001067291.1 type II toxin-antitoxin system antitoxin SocA domain-containing protein -
  L2Z42_RS06985 (L2Z42_06985) umuD 1414697..1415191 (+) 495 WP_001289330.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
  L2Z42_RS06990 (L2Z42_06990) - 1415195..1416493 (+) 1299 WP_000679992.1 Y-family DNA polymerase -
  L2Z42_RS06995 (L2Z42_06995) - 1416531..1417043 (+) 513 WP_001084012.1 hypothetical protein -
  L2Z42_RS07000 (L2Z42_07000) - 1417185..1418117 (+) 933 Protein_1382 IS5 family transposase -
  L2Z42_RS07005 (L2Z42_07005) - 1418223..1418765 (-) 543 WP_001019729.1 N-acetylmuramidase -
  L2Z42_RS07010 (L2Z42_07010) - 1418808..1419197 (-) 390 WP_000433902.1 hypothetical protein -
  L2Z42_RS07015 (L2Z42_07015) - 1419261..1421750 (-) 2490 WP_031977643.1 phage tail protein -
  L2Z42_RS07020 (L2Z42_07020) - 1421751..1422173 (-) 423 WP_000792723.1 NlpC/P60 family protein -
  L2Z42_RS07025 (L2Z42_07025) - 1422174..1422944 (-) 771 WP_000008889.1 hypothetical protein -
  L2Z42_RS07030 (L2Z42_07030) - 1422948..1424750 (-) 1803 WP_001130838.1 sialate O-acetylesterase -
  L2Z42_RS07035 (L2Z42_07035) - 1424807..1425664 (-) 858 WP_001248150.1 DUF2163 domain-containing protein -
  L2Z42_RS07040 (L2Z42_07040) - 1425661..1426314 (-) 654 WP_000073188.1 DUF2460 domain-containing protein -
  L2Z42_RS07045 (L2Z42_07045) - 1426325..1429363 (-) 3039 WP_031977640.1 tail protein -
  L2Z42_RS07050 (L2Z42_07050) - 1429458..1429958 (-) 501 WP_001229359.1 zinc ribbon domain-containing protein -
  L2Z42_RS07055 (L2Z42_07055) - 1430029..1430256 (-) 228 WP_000513918.1 hypothetical protein -
  L2Z42_RS07060 (L2Z42_07060) - 1430292..1430606 (-) 315 WP_001159813.1 hypothetical protein -
  L2Z42_RS07065 (L2Z42_07065) - 1430613..1431380 (-) 768 WP_000090027.1 hypothetical protein -
  L2Z42_RS07070 (L2Z42_07070) - 1431443..1431886 (-) 444 WP_000376614.1 hypothetical protein -
  L2Z42_RS07075 (L2Z42_07075) - 1431879..1432361 (-) 483 WP_001287055.1 hypothetical protein -
  L2Z42_RS07080 (L2Z42_07080) - 1432369..1432560 (-) 192 WP_001116150.1 hypothetical protein -
  L2Z42_RS07085 (L2Z42_07085) - 1432570..1432953 (-) 384 WP_000383137.1 DUF4054 domain-containing protein -
  L2Z42_RS07090 (L2Z42_07090) - 1432963..1433346 (-) 384 WP_000877802.1 hypothetical protein -
  L2Z42_RS07095 (L2Z42_07095) - 1433361..1434335 (-) 975 WP_000039808.1 DUF2184 domain-containing protein -
  L2Z42_RS07100 (L2Z42_07100) - 1434341..1434811 (-) 471 WP_000240726.1 hypothetical protein -
  L2Z42_RS07105 (L2Z42_07105) - 1434825..1436027 (-) 1203 WP_000160522.1 DUF2213 domain-containing protein -
  L2Z42_RS07110 (L2Z42_07110) - 1436270..1436569 (-) 300 WP_000823404.1 hypothetical protein -
  L2Z42_RS07115 (L2Z42_07115) - 1436658..1437209 (+) 552 WP_001016202.1 hypothetical protein -
  L2Z42_RS07120 (L2Z42_07120) - 1437181..1437993 (-) 813 WP_000207480.1 phage minor head protein -
  L2Z42_RS07125 (L2Z42_07125) - 1437938..1439272 (-) 1335 WP_000852317.1 DUF1073 domain-containing protein -
  L2Z42_RS07130 (L2Z42_07130) terL 1439281..1440807 (-) 1527 WP_001088670.1 phage terminase large subunit -
  L2Z42_RS07135 (L2Z42_07135) - 1440785..1441261 (-) 477 WP_000729394.1 DUF2280 domain-containing protein -
  L2Z42_RS07140 (L2Z42_07140) - 1441320..1441961 (-) 642 WP_049594846.1 putative metallopeptidase -
  L2Z42_RS07145 (L2Z42_07145) - 1441930..1442358 (-) 429 WP_000348740.1 hypothetical protein -
  L2Z42_RS07150 (L2Z42_07150) - 1442371..1442562 (-) 192 WP_000134358.1 hypothetical protein -
  L2Z42_RS07155 (L2Z42_07155) - 1443024..1443758 (-) 735 WP_000959672.1 hypothetical protein -
  L2Z42_RS07160 (L2Z42_07160) - 1443769..1444170 (-) 402 WP_000100167.1 DUF559 domain-containing protein -
  L2Z42_RS07165 (L2Z42_07165) - 1444170..1444385 (-) 216 WP_001288428.1 hypothetical protein -
  L2Z42_RS07170 (L2Z42_07170) - 1444378..1444779 (-) 402 WP_000778995.1 HNH endonuclease -
  L2Z42_RS07175 (L2Z42_07175) - 1444776..1445183 (-) 408 WP_000017854.1 hypothetical protein -
  L2Z42_RS07180 (L2Z42_07180) - 1445180..1445929 (-) 750 WP_000544517.1 hypothetical protein -
  L2Z42_RS07185 (L2Z42_07185) - 1445922..1446872 (-) 951 WP_001110397.1 YdaU family protein -
  L2Z42_RS07190 (L2Z42_07190) - 1446869..1447783 (-) 915 WP_001003656.1 DNA cytosine methyltransferase -
  L2Z42_RS07195 (L2Z42_07195) - 1447780..1448067 (-) 288 WP_001194329.1 hypothetical protein -
  L2Z42_RS07200 (L2Z42_07200) - 1448118..1448618 (-) 501 WP_001289843.1 phage regulatory CII family protein -
  L2Z42_RS07205 (L2Z42_07205) - 1448673..1448921 (-) 249 WP_000210973.1 Cro/CI family transcriptional regulator -
  L2Z42_RS07210 (L2Z42_07210) - 1448924..1449715 (+) 792 WP_000187984.1 S24 family peptidase -
  L2Z42_RS07215 (L2Z42_07215) - 1449943..1450383 (+) 441 WP_001101454.1 hypothetical protein -
  L2Z42_RS07220 (L2Z42_07220) - 1450386..1450709 (+) 324 WP_000181031.1 hypothetical protein -
  L2Z42_RS07225 (L2Z42_07225) - 1450721..1451488 (+) 768 WP_000206151.1 hypothetical protein -
  L2Z42_RS07230 (L2Z42_07230) - 1451503..1452462 (+) 960 WP_000067517.1 hypothetical protein -
  L2Z42_RS07235 (L2Z42_07235) - 1452464..1452715 (+) 252 WP_049594847.1 hypothetical protein -
  L2Z42_RS07240 (L2Z42_07240) - 1452716..1453123 (+) 408 WP_049594848.1 hypothetical protein -
  L2Z42_RS07245 (L2Z42_07245) - 1453120..1453404 (+) 285 WP_000048746.1 hypothetical protein -
  L2Z42_RS07250 (L2Z42_07250) - 1453408..1453665 (+) 258 WP_000015931.1 hypothetical protein -
  L2Z42_RS07255 (L2Z42_07255) - 1453667..1453882 (+) 216 WP_000362184.1 hypothetical protein -
  L2Z42_RS07260 (L2Z42_07260) - 1454092..1455372 (+) 1281 WP_001185176.1 aspartate kinase -
  L2Z42_RS07265 (L2Z42_07265) csrA 1455619..1455873 (+) 255 WP_000906487.1 carbon storage regulator CsrA -

Sequence

Protein


Download         Length: 235 a.a.        Molecular weight: 26567.18 Da        Isoelectric Point: 4.6625

>NTDB_id=649355 L2Z42_RS06930 WP_000203217.1 1401130..1401837(+) (crp) [Acinetobacter baumannii strain ATCC17978-VUB]
MTSNFSQLSTDALSPGQLPESVKALLKRAHINRYPKRTTIVDAGTESKSLYLILKGSVSIILREDDEREIVVAYLNPGDF
FGEMGLFEPNPQRTAEVRTRDVCEIAEISYDNFHELSKQYPDLSYAVFAQLVRRLKNTTRKMTDLAFIDVSGRIARCLID
LSSQPEAMILPNGRQIRITRQEIGRIVGCSREMVGRVLKTLEDQGMIQTDGKAILIFDTSLEETPVTDEDYDDEE

Nucleotide


Download         Length: 708 bp        

>NTDB_id=649355 L2Z42_RS06930 WP_000203217.1 1401130..1401837(+) (crp) [Acinetobacter baumannii strain ATCC17978-VUB]
ATGACTTCAAATTTTTCACAACTCAGCACAGATGCTTTATCTCCGGGGCAACTACCTGAATCCGTTAAAGCATTGTTAAA
ACGTGCTCACATCAACAGATATCCAAAACGAACCACAATTGTTGATGCCGGAACAGAGTCAAAATCTTTATATTTAATTT
TAAAAGGCTCAGTTTCAATTATTTTACGTGAAGACGATGAACGTGAAATTGTTGTGGCATATTTGAATCCTGGTGACTTC
TTTGGGGAAATGGGGCTTTTCGAACCGAACCCTCAACGTACAGCTGAAGTTCGTACCCGTGATGTCTGTGAAATTGCGGA
AATTTCATATGACAACTTCCACGAACTGAGCAAACAGTATCCAGATCTCAGCTATGCCGTTTTCGCGCAACTCGTTCGTC
GTTTAAAAAATACAACTCGTAAAATGACCGATCTTGCATTTATTGATGTGTCAGGCCGTATTGCGCGTTGCTTAATCGAC
CTATCTTCACAACCAGAAGCAATGATCTTGCCGAATGGCCGTCAAATTCGTATTACTCGACAAGAGATTGGACGCATTGT
CGGGTGTTCACGAGAAATGGTTGGCCGTGTATTAAAGACCTTAGAAGATCAAGGTATGATTCAAACTGACGGTAAAGCTA
TTTTGATTTTTGATACTTCATTAGAAGAAACCCCAGTCACTGACGAAGACTATGATGACGAAGAATAA

Domains

Predicted by InterproScan.

Crp-like helix-turn-helix domain (HTH_Crp_2)

(152-218)

Cyclic nucleotide-binding domain (cNMP_binding)

(33-120)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  crp Acinetobacter baumannii D1279779

99.574

100

0.996
  crp Vibrio cholerae strain A1552

47.343

88.085

0.417
  crp Haemophilus influenzae Rd KW20

48.705

82.128

0.4