Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LQ055_RS00375 | Genome accession | NZ_CP091231 |
| Coordinates | 76516..77043 (+) | Length | 175 a.a. |
| NCBI ID | WP_010826244.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis strain 732 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 66483..110327 | 76516..77043 | within | 0 |
Gene organization within MGE regions
Location: 66483..110327
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ055_RS00285 (LQ055_00285) | - | 66483..67832 (-) | 1350 | WP_002411357.1 | recombinase family protein | - |
| LQ055_RS00290 (LQ055_00290) | - | 67861..68043 (-) | 183 | WP_002411356.1 | hypothetical protein | - |
| LQ055_RS00295 (LQ055_00295) | - | 68208..68924 (-) | 717 | WP_229017980.1 | XRE family transcriptional regulator | - |
| LQ055_RS00300 (LQ055_00300) | - | 69070..69276 (+) | 207 | WP_002411354.1 | helix-turn-helix transcriptional regulator | - |
| LQ055_RS00305 (LQ055_00305) | - | 69314..69475 (+) | 162 | WP_002411353.1 | hypothetical protein | - |
| LQ055_RS00310 (LQ055_00310) | - | 69533..69739 (+) | 207 | WP_126268783.1 | hypothetical protein | - |
| LQ055_RS00315 (LQ055_00315) | - | 69744..69926 (+) | 183 | WP_010821528.1 | hypothetical protein | - |
| LQ055_RS00320 (LQ055_00320) | - | 69921..70451 (-) | 531 | WP_010821529.1 | hypothetical protein | - |
| LQ055_RS00325 (LQ055_00325) | - | 70530..70745 (+) | 216 | WP_002357335.1 | hypothetical protein | - |
| LQ055_RS00330 (LQ055_00330) | - | 71014..71724 (+) | 711 | WP_010821530.1 | Rha family transcriptional regulator | - |
| LQ055_RS00335 (LQ055_00335) | - | 71735..71920 (+) | 186 | WP_002364665.1 | hypothetical protein | - |
| LQ055_RS00340 (LQ055_00340) | - | 71932..72108 (+) | 177 | WP_010711635.1 | hypothetical protein | - |
| LQ055_RS00345 (LQ055_00345) | - | 72248..72808 (-) | 561 | WP_064687099.1 | hypothetical protein | - |
| LQ055_RS00350 (LQ055_00350) | - | 73093..73836 (+) | 744 | WP_010708942.1 | ERF family protein | - |
| LQ055_RS00355 (LQ055_00355) | - | 73836..74774 (+) | 939 | WP_010783683.1 | DUF1351 domain-containing protein | - |
| LQ055_RS00360 (LQ055_00360) | - | 74771..75412 (+) | 642 | WP_160816516.1 | putative HNHc nuclease | - |
| LQ055_RS00365 (LQ055_00365) | - | 75416..76213 (+) | 798 | WP_010784194.1 | helix-turn-helix domain-containing protein | - |
| LQ055_RS00370 (LQ055_00370) | - | 76218..76526 (+) | 309 | WP_010822654.1 | MazG-like family protein | - |
| LQ055_RS00375 (LQ055_00375) | ssb | 76516..77043 (+) | 528 | WP_010826244.1 | single-stranded DNA-binding protein | Machinery gene |
| LQ055_RS00380 (LQ055_00380) | - | 77056..77385 (+) | 330 | WP_049097668.1 | hypothetical protein | - |
| LQ055_RS00385 (LQ055_00385) | - | 77405..77611 (+) | 207 | WP_002395701.1 | hypothetical protein | - |
| LQ055_RS00390 (LQ055_00390) | - | 77664..78404 (+) | 741 | WP_002410993.1 | hypothetical protein | - |
| LQ055_RS00395 (LQ055_00395) | - | 78422..79114 (+) | 693 | WP_010818750.1 | N-6 DNA methylase | - |
| LQ055_RS00400 (LQ055_00400) | - | 79111..80055 (+) | 945 | WP_002406057.1 | site-specific integrase | - |
| LQ055_RS00405 (LQ055_00405) | - | 80068..80640 (+) | 573 | WP_095715049.1 | hypothetical protein | - |
| LQ055_RS00410 (LQ055_00410) | - | 80624..81004 (+) | 381 | WP_010731652.1 | YopX family protein | - |
| LQ055_RS00415 (LQ055_00415) | - | 81110..81336 (+) | 227 | Protein_82 | hypothetical protein | - |
| LQ055_RS00420 (LQ055_00420) | - | 81336..81473 (+) | 138 | WP_002414887.1 | hypothetical protein | - |
| LQ055_RS00425 (LQ055_00425) | - | 81470..81991 (+) | 522 | WP_249488590.1 | DUF1642 domain-containing protein | - |
| LQ055_RS00430 (LQ055_00430) | - | 82174..82383 (+) | 210 | WP_002402424.1 | hypothetical protein | - |
| LQ055_RS00435 (LQ055_00435) | - | 82384..82803 (+) | 420 | WP_002404562.1 | transcriptional regulator | - |
| LQ055_RS00445 (LQ055_00445) | - | 83836..84669 (+) | 834 | WP_104807413.1 | terminase small subunit | - |
| LQ055_RS00450 (LQ055_00450) | - | 84659..85948 (+) | 1290 | WP_002411228.1 | PBSX family phage terminase large subunit | - |
| LQ055_RS00455 (LQ055_00455) | - | 85964..87463 (+) | 1500 | WP_142968830.1 | phage portal protein | - |
| LQ055_RS00460 (LQ055_00460) | - | 87463..88620 (+) | 1158 | WP_002411227.1 | phage minor capsid protein | - |
| LQ055_RS00465 (LQ055_00465) | - | 88704..88967 (+) | 264 | WP_025188247.1 | DUF6275 family protein | - |
| LQ055_RS00470 (LQ055_00470) | - | 89073..89627 (+) | 555 | WP_010784200.1 | phage scaffolding protein | - |
| LQ055_RS00475 (LQ055_00475) | - | 89644..90510 (+) | 867 | WP_002357374.1 | hypothetical protein | - |
| LQ055_RS00480 (LQ055_00480) | - | 90608..91012 (+) | 405 | WP_002411223.1 | hypothetical protein | - |
| LQ055_RS00485 (LQ055_00485) | - | 91006..91347 (+) | 342 | WP_002411222.1 | putative minor capsid protein | - |
| LQ055_RS00490 (LQ055_00490) | - | 91347..91673 (+) | 327 | WP_002411221.1 | minor capsid protein | - |
| LQ055_RS00495 (LQ055_00495) | - | 91673..92071 (+) | 399 | WP_002411220.1 | minor capsid protein | - |
| LQ055_RS00500 (LQ055_00500) | - | 92071..92550 (+) | 480 | WP_010784202.1 | hypothetical protein | - |
| LQ055_RS00505 (LQ055_00505) | - | 92621..93073 (+) | 453 | WP_249488591.1 | phage tail protein | - |
| LQ055_RS00510 (LQ055_00510) | - | 93126..93545 (+) | 420 | WP_002411217.1 | DUF6673 family protein | - |
| LQ055_RS00515 (LQ055_00515) | - | 93551..94123 (+) | 573 | WP_010784204.1 | Gp15 family bacteriophage protein | - |
| LQ055_RS00520 (LQ055_00520) | - | 94116..97436 (+) | 3321 | WP_033787715.1 | hypothetical protein | - |
| LQ055_RS00525 (LQ055_00525) | - | 97436..98197 (+) | 762 | WP_085368125.1 | distal tail protein Dit | - |
| LQ055_RS00530 (LQ055_00530) | - | 98194..100461 (+) | 2268 | WP_148251868.1 | phage tail spike protein | - |
| LQ055_RS00535 (LQ055_00535) | - | 100461..101954 (+) | 1494 | WP_148251869.1 | BppU family phage baseplate upper protein | - |
| LQ055_RS00540 (LQ055_00540) | - | 102022..102243 (+) | 222 | WP_002406118.1 | hypothetical protein | - |
| LQ055_RS00545 (LQ055_00545) | - | 102236..102472 (+) | 237 | WP_002411209.1 | phage holin | - |
| LQ055_RS00550 (LQ055_00550) | - | 102469..103554 (+) | 1086 | WP_010784207.1 | SH3 domain-containing protein | - |
| LQ055_RS00555 (LQ055_00555) | - | 103949..104482 (+) | 534 | WP_002402066.1 | PBECR4 domain-containing protein | - |
| LQ055_RS00565 (LQ055_00565) | - | 104637..108512 (+) | 3876 | Protein_110 | 5'-nucleotidase C-terminal domain-containing protein | - |
| LQ055_RS00570 (LQ055_00570) | - | 108648..110327 (+) | 1680 | WP_002361487.1 | peptide ABC transporter substrate-binding protein | - |
Sequence
Protein
Download Length: 175 a.a. Molecular weight: 19235.07 Da Isoelectric Point: 4.7078
>NTDB_id=648641 LQ055_RS00375 WP_010826244.1 76516..77043(+) (ssb) [Enterococcus faecalis strain 732]
MINNVVLVGRLTKDPDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLEAKSANENRNSIQSSQNSVTGVQNNFESNYAANQNKGLNQQNNSQQISFGGDVDPFA
GAGNSIDISDDDLPF
MINNVVLVGRLTKDPDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLEAKSANENRNSIQSSQNSVTGVQNNFESNYAANQNKGLNQQNNSQQISFGGDVDPFA
GAGNSIDISDDDLPF
Nucleotide
Download Length: 528 bp
>NTDB_id=648641 LQ055_RS00375 WP_010826244.1 76516..77043(+) (ssb) [Enterococcus faecalis strain 732]
ATGATAAATAATGTGGTATTAGTCGGAAGATTGACAAAAGATCCTGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGTAAAGGAACATTATTAGGAGTTGTTGGCAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTGTTTGCGAGAGTTTCCAATTATTAGAGGCAAAAAG
CGCCAATGAGAATAGAAATAGCATTCAGAGTTCACAGAATAGCGTTACAGGCGTTCAAAATAATTTCGAGAGTAATTATG
CTGCGAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATATCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGTGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCGTTCTAG
ATGATAAATAATGTGGTATTAGTCGGAAGATTGACAAAAGATCCTGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGTAAAGGAACATTATTAGGAGTTGTTGGCAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTGTTTGCGAGAGTTTCCAATTATTAGAGGCAAAAAG
CGCCAATGAGAATAGAAATAGCATTCAGAGTTCACAGAATAGCGTTACAGGCGTTCAAAATAATTTCGAGAGTAATTATG
CTGCGAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATATCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGTGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.989 |
100 |
0.6 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
57.303 |
100 |
0.583 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
60.571 |
0.36 |