Detailed information    

insolico Bioinformatically predicted

Overview

Name   dprA   Type   Machinery gene
Locus tag   KB230_RS07310 Genome accession   NZ_CP090922
Coordinates   1573463..1574335 (-) Length   290 a.a.
NCBI ID   WP_234966976.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain 45A6     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1526820..1603156 1573463..1574335 within 0


Gene organization within MGE regions


Location: 1526820..1603156
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KB230_RS07120 (KB230_07120) - 1527146..1527361 (+) 216 WP_002439555.1 hypothetical protein -
  KB230_RS07125 (KB230_07125) rny 1527449..1529008 (-) 1560 WP_001829512.1 ribonuclease Y -
  KB230_RS07130 (KB230_07130) recA 1529234..1530283 (-) 1050 WP_002439552.1 recombinase RecA Machinery gene
  KB230_RS07135 (KB230_07135) - 1530454..1531599 (-) 1146 WP_002439549.1 CinA family nicotinamide mononucleotide deamidase-related protein -
  KB230_RS07140 (KB230_07140) pgsA 1532052..1532633 (-) 582 WP_002503396.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  KB230_RS07145 (KB230_07145) - 1532662..1533054 (-) 393 WP_001832565.1 helix-turn-helix domain-containing protein -
  KB230_RS07150 (KB230_07150) - 1533073..1533900 (-) 828 WP_002456221.1 YmfK family protein -
  KB230_RS07155 (KB230_07155) ymfI 1534053..1534757 (-) 705 WP_002439542.1 elongation factor P 5-aminopentanone reductase -
  KB230_RS07160 (KB230_07160) yfmH 1534754..1536043 (-) 1290 WP_234966970.1 EF-P 5-aminopentanol modification-associated protein YfmH -
  KB230_RS07165 (KB230_07165) yfmF 1536043..1537314 (-) 1272 WP_002439538.1 EF-P 5-aminopentanol modification-associated protein YfmF -
  KB230_RS07170 (KB230_07170) - 1537345..1538058 (-) 714 WP_002439536.1 GntR family transcriptional regulator -
  KB230_RS07175 (KB230_07175) - 1538061..1540454 (-) 2394 WP_234966971.1 DNA translocase FtsK -
  KB230_RS07180 (KB230_07180) rnjB 1540720..1542393 (-) 1674 WP_002457357.1 ribonuclease J2 -
  KB230_RS07185 (KB230_07185) pnp 1542761..1544866 (-) 2106 WP_234966972.1 polyribonucleotide nucleotidyltransferase -
  KB230_RS07190 (KB230_07190) rpsO 1544998..1545267 (-) 270 WP_002439528.1 30S ribosomal protein S15 -
  KB230_RS07195 (KB230_07195) - 1545387..1546358 (-) 972 WP_001832563.1 bifunctional riboflavin kinase/FAD synthetase -
  KB230_RS07200 (KB230_07200) truB 1546374..1547291 (-) 918 WP_234966973.1 tRNA pseudouridine(55) synthase TruB -
  KB230_RS07205 (KB230_07205) rbfA 1547429..1547779 (-) 351 WP_002457359.1 30S ribosome-binding factor RbfA -
  KB230_RS07210 (KB230_07210) infB 1548082..1550244 (-) 2163 WP_002468903.1 translation initiation factor IF-2 -
  KB230_RS07215 (KB230_07215) - 1550249..1550566 (-) 318 WP_002439520.1 YlxQ family RNA-binding protein -
  KB230_RS07220 (KB230_07220) rnpM 1550566..1550850 (-) 285 WP_001829465.1 RNase P modulator RnpM -
  KB230_RS07225 (KB230_07225) nusA 1550868..1552091 (-) 1224 WP_001829457.1 transcription termination factor NusA -
  KB230_RS07230 (KB230_07230) rimP 1552112..1552579 (-) 468 WP_002439519.1 ribosome maturation factor RimP -
  KB230_RS07235 (KB230_07235) - 1552758..1557068 (-) 4311 WP_233662769.1 PolC-type DNA polymerase III -
  KB230_RS07240 (KB230_07240) - 1557319..1559022 (-) 1704 WP_001829513.1 proline--tRNA ligase -
  KB230_RS07245 (KB230_07245) rseP 1559041..1560327 (-) 1287 WP_234966974.1 RIP metalloprotease RseP -
  KB230_RS07250 (KB230_07250) - 1560561..1561343 (-) 783 WP_001829499.1 phosphatidate cytidylyltransferase -
  KB230_RS07255 (KB230_07255) - 1561347..1562117 (-) 771 WP_001832561.1 isoprenyl transferase -
  KB230_RS07260 (KB230_07260) frr 1562338..1562892 (-) 555 WP_001829472.1 ribosome recycling factor -
  KB230_RS07265 (KB230_07265) pyrH 1562909..1563631 (-) 723 WP_002439511.1 UMP kinase -
  KB230_RS07270 (KB230_07270) tsf 1563772..1564650 (-) 879 WP_002439509.1 translation elongation factor Ts -
  KB230_RS07275 (KB230_07275) rpsB 1564802..1565590 (-) 789 WP_001832557.1 30S ribosomal protein S2 -
  KB230_RS07280 (KB230_07280) codY 1565949..1566722 (-) 774 WP_002446289.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  KB230_RS07285 (KB230_07285) hslU 1566746..1568149 (-) 1404 WP_001829474.1 ATP-dependent protease ATPase subunit HslU -
  KB230_RS07290 (KB230_07290) hslV 1568218..1568760 (-) 543 WP_001829498.1 ATP-dependent protease subunit HslV -
  KB230_RS07295 (KB230_07295) xerC 1568764..1569624 (-) 861 WP_002439503.1 tyrosine recombinase XerC -
  KB230_RS07300 (KB230_07300) trmFO 1569879..1571186 (-) 1308 WP_234966975.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  KB230_RS07305 (KB230_07305) topA 1571211..1573280 (-) 2070 WP_001829508.1 type I DNA topoisomerase -
  KB230_RS07310 (KB230_07310) dprA 1573463..1574335 (-) 873 WP_234966976.1 DNA-processing protein DprA Machinery gene
  KB230_RS07320 (KB230_07320) sucD 1575141..1576049 (-) 909 WP_002446283.1 succinate--CoA ligase subunit alpha -
  KB230_RS07325 (KB230_07325) sucC 1576071..1577237 (-) 1167 WP_002439496.1 ADP-forming succinate--CoA ligase subunit beta -
  KB230_RS07330 (KB230_07330) - 1577345..1578115 (-) 771 WP_001829514.1 ribonuclease HII -
  KB230_RS07335 (KB230_07335) ylqF 1578120..1578983 (-) 864 WP_001829495.1 ribosome biogenesis GTPase YlqF -
  KB230_RS07340 (KB230_07340) - 1579004..1579153 (-) 150 WP_162154119.1 hypothetical protein -
  KB230_RS07345 (KB230_07345) - 1579312..1581912 (+) 2601 WP_234966977.1 YfhO family protein -
  KB230_RS07350 (KB230_07350) - 1581905..1584508 (+) 2604 WP_002489341.1 YfhO family protein -
  KB230_RS07355 (KB230_07355) rplS 1585038..1585388 (-) 351 WP_002436293.1 50S ribosomal protein L19 -
  KB230_RS07360 (KB230_07360) trmD 1585494..1586231 (-) 738 WP_001829466.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  KB230_RS07365 (KB230_07365) rimM 1586231..1586734 (-) 504 WP_001832559.1 ribosome maturation factor RimM -
  KB230_RS07370 (KB230_07370) rpsP 1586861..1587136 (-) 276 WP_002439483.1 30S ribosomal protein S16 -
  KB230_RS07375 (KB230_07375) ffh 1587444..1588811 (-) 1368 WP_001830113.1 signal recognition particle protein -
  KB230_RS07380 (KB230_07380) - 1588842..1589174 (-) 333 WP_002457379.1 putative DNA-binding protein -
  KB230_RS07385 (KB230_07385) ftsY 1589176..1590402 (-) 1227 WP_002476650.1 signal recognition particle-docking protein FtsY -
  KB230_RS07390 (KB230_07390) smc 1590399..1593968 (-) 3570 WP_002502931.1 chromosome segregation protein SMC -
  KB230_RS07395 (KB230_07395) rnc 1594095..1594832 (-) 738 WP_002456575.1 ribonuclease III -
  KB230_RS07400 (KB230_07400) - 1594947..1595180 (-) 234 WP_001830184.1 acyl carrier protein -
  KB230_RS07405 (KB230_07405) fabG 1595344..1596078 (-) 735 WP_001830161.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  KB230_RS07410 (KB230_07410) fabD 1596071..1596997 (-) 927 WP_002473278.1 ACP S-malonyltransferase -
  KB230_RS07415 (KB230_07415) plsX 1596999..1597976 (-) 978 WP_001830112.1 phosphate acyltransferase PlsX -
  KB230_RS07420 (KB230_07420) fapR 1597978..1598538 (-) 561 WP_001830099.1 transcription factor FapR -
  KB230_RS07425 (KB230_07425) recG 1598697..1600745 (-) 2049 WP_002489349.1 ATP-dependent DNA helicase RecG -
  KB230_RS07430 (KB230_07430) fakA 1600950..1602608 (-) 1659 WP_002489351.1 fatty acid kinase catalytic subunit FakA -
  KB230_RS07435 (KB230_07435) - 1602623..1602997 (-) 375 WP_001830156.1 Asp23/Gls24 family envelope stress response protein -

Sequence

Protein


Download         Length: 290 a.a.        Molecular weight: 33758.66 Da        Isoelectric Point: 9.3618

>NTDB_id=646486 KB230_RS07310 WP_234966976.1 1573463..1574335(-) (dprA) [Staphylococcus epidermidis strain 45A6]
MIQHTMLKLYWANFTTAQLHHLTSTYPDFLSENVFHQHDMIKRWLTERNSERLWNKYERFKELKLMDIIKDMKKANVSFT
TYFDDNYPSLCKEMYDYPYVIFYKGNPQFFNHSHSLAVIGSRNATQYTSQSLNYLFLSFRQLNMAIVSGLARGADSVAHQ
TALKYLLPTIGVLGFSHCYHYPKATLNLRTKVERNGLVISEYPPFSPISKHKFPERNRLISGLSRGVLITEAEERSGSQI
TIDCALEQNRNVYVLPGSMFNKMTKGNLRRINEGAQVVIDESSILYDYLF

Nucleotide


Download         Length: 873 bp        

>NTDB_id=646486 KB230_RS07310 WP_234966976.1 1573463..1574335(-) (dprA) [Staphylococcus epidermidis strain 45A6]
TTGATACAACATACGATGTTAAAACTATATTGGGCAAATTTCACTACGGCACAACTTCATCATCTTACAAGTACATATCC
TGACTTTCTATCAGAAAACGTATTTCATCAACATGACATGATAAAAAGGTGGCTTACAGAGCGTAATTCTGAAAGGCTAT
GGAACAAATATGAACGTTTCAAAGAATTAAAGCTGATGGACATTATTAAAGATATGAAAAAAGCAAATGTTAGTTTTACA
ACATACTTTGATGATAACTACCCTTCTCTTTGCAAAGAAATGTATGATTATCCTTATGTGATATTCTACAAAGGAAATCC
ACAGTTCTTTAATCATTCTCACTCTTTAGCTGTAATTGGCTCACGTAATGCCACACAATATACAAGTCAATCTTTAAACT
ATCTTTTTCTTTCATTTAGACAATTAAATATGGCGATTGTTTCTGGATTAGCGCGCGGTGCAGATAGTGTAGCACATCAA
ACCGCACTTAAATACCTATTACCAACTATTGGCGTACTTGGATTTAGCCATTGTTATCATTATCCTAAAGCAACCTTAAA
TTTAAGAACTAAAGTTGAAAGGAATGGCTTAGTGATAAGTGAATATCCACCATTTTCTCCTATAAGTAAGCATAAATTTC
CTGAAAGAAACAGGCTTATAAGTGGTCTGTCCAGAGGGGTACTTATAACTGAGGCTGAAGAAAGAAGTGGTAGTCAAATC
ACTATCGATTGTGCTTTAGAGCAAAATAGAAATGTTTATGTTCTACCTGGTTCAATGTTCAACAAAATGACTAAAGGTAA
TTTAAGAAGGATAAATGAAGGTGCTCAAGTTGTTATAGATGAAAGTAGTATATTATATGATTATCTATTTTAG

Domains

Predicted by InterproScan.

DNA recombination-mediator protein A (DNA_processg_A)

(72-279)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus MW2

56.25

99.31

0.559
  dprA Staphylococcus aureus N315

56.25

99.31

0.559