Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   L0961_RS12265 Genome accession   NZ_CP090905
Coordinates   2511930..2512307 (-) Length   125 a.a.
NCBI ID   WP_003153092.1    Uniprot ID   -
Organism   Bacillus velezensis strain Yao     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2506930..2517307
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L0961_RS12225 (L0961_12225) - 2507429..2508223 (+) 795 WP_003153106.1 YqhG family protein -
  L0961_RS12230 (L0961_12230) sinI 2508400..2508573 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  L0961_RS12235 (L0961_12235) sinR 2508607..2508942 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  L0961_RS12240 (L0961_12240) tasA 2508990..2509775 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  L0961_RS12245 (L0961_12245) sipW 2509839..2510423 (-) 585 WP_012117977.1 signal peptidase I SipW -
  L0961_RS12250 (L0961_12250) tapA 2510395..2511066 (-) 672 WP_234949395.1 amyloid fiber anchoring/assembly protein TapA -
  L0961_RS12255 (L0961_12255) - 2511325..2511654 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  L0961_RS12260 (L0961_12260) - 2511694..2511873 (-) 180 WP_003153093.1 YqzE family protein -
  L0961_RS12265 (L0961_12265) comGG 2511930..2512307 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  L0961_RS12270 (L0961_12270) comGF 2512308..2512703 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  L0961_RS12275 (L0961_12275) comGE 2512717..2513031 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  L0961_RS12280 (L0961_12280) comGD 2513015..2513452 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  L0961_RS12285 (L0961_12285) comGC 2513442..2513750 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  L0961_RS12290 (L0961_12290) comGB 2513755..2514792 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  L0961_RS12295 (L0961_12295) comGA 2514779..2515849 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  L0961_RS12300 (L0961_12300) - 2516048..2516998 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14169.15 Da        Isoelectric Point: 10.1579

>NTDB_id=646311 L0961_RS12265 WP_003153092.1 2511930..2512307(-) (comGG) [Bacillus velezensis strain Yao]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSNRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=646311 L0961_RS12265 WP_003153092.1 2511930..2512307(-) (comGG) [Bacillus velezensis strain Yao]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTAATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512