Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   L0961_RS12230 Genome accession   NZ_CP090905
Coordinates   2508400..2508573 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain Yao     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2503400..2513573
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L0961_RS12215 (L0961_12215) gcvT 2504218..2505318 (-) 1101 WP_058906182.1 glycine cleavage system aminomethyltransferase GcvT -
  L0961_RS12220 (L0961_12220) - 2505741..2507411 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  L0961_RS12225 (L0961_12225) - 2507429..2508223 (+) 795 WP_003153106.1 YqhG family protein -
  L0961_RS12230 (L0961_12230) sinI 2508400..2508573 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  L0961_RS12235 (L0961_12235) sinR 2508607..2508942 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  L0961_RS12240 (L0961_12240) tasA 2508990..2509775 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  L0961_RS12245 (L0961_12245) sipW 2509839..2510423 (-) 585 WP_012117977.1 signal peptidase I SipW -
  L0961_RS12250 (L0961_12250) tapA 2510395..2511066 (-) 672 WP_234949395.1 amyloid fiber anchoring/assembly protein TapA -
  L0961_RS12255 (L0961_12255) - 2511325..2511654 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  L0961_RS12260 (L0961_12260) - 2511694..2511873 (-) 180 WP_003153093.1 YqzE family protein -
  L0961_RS12265 (L0961_12265) comGG 2511930..2512307 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  L0961_RS12270 (L0961_12270) comGF 2512308..2512703 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  L0961_RS12275 (L0961_12275) comGE 2512717..2513031 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  L0961_RS12280 (L0961_12280) comGD 2513015..2513452 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=646309 L0961_RS12230 WP_003153105.1 2508400..2508573(+) (sinI) [Bacillus velezensis strain Yao]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=646309 L0961_RS12230 WP_003153105.1 2508400..2508573(+) (sinI) [Bacillus velezensis strain Yao]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702