Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   L1A15_RS02755 Genome accession   NZ_CP090884
Coordinates   524295..524444 (+) Length   49 a.a.
NCBI ID   WP_001808912.1    Uniprot ID   A0A4J1ZTW6
Organism   Streptococcus pneumoniae strain MD5403     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 519295..529444
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L1A15_RS02735 (L1A15_02735) blpC 519606..519761 (-) 156 WP_000358813.1 quorum-sensing system pheromone BlpC -
  L1A15_RS02740 (L1A15_02740) - 519818..521179 (-) 1362 WP_001069092.1 bacteriocin secretion accessory protein -
  L1A15_RS10495 comA/nlmT 521190..521678 (-) 489 WP_307774349.1 ATP-binding cassette domain-containing protein Regulator
  L1A15_RS10500 comA/nlmT 521662..522102 (-) 441 WP_001808911.1 ATP-binding cassette domain-containing protein Regulator
  L1A15_RS10505 comA/nlmT 522092..522817 (-) 726 WP_167750760.1 ABC transporter transmembrane domain-containing protein Regulator
  L1A15_RS10510 comA/nlmT 522762..523349 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  L1A15_RS02750 (L1A15_02750) blpI 523631..523828 (+) 198 WP_001093258.1 bacteriocin-like peptide BlpI -
  L1A15_RS02755 (L1A15_02755) cipB 524295..524444 (+) 150 WP_001808912.1 bacteriocin-like peptide BlpO Regulator
  L1A15_RS02760 (L1A15_02760) - 524548..524667 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  L1A15_RS02765 (L1A15_02765) - 525453..525836 (+) 384 WP_000877381.1 hypothetical protein -
  L1A15_RS02770 (L1A15_02770) - 525888..526577 (+) 690 WP_000760526.1 CPBP family intramembrane glutamic endopeptidase -
  L1A15_RS02775 (L1A15_02775) blpZ 526619..526867 (+) 249 WP_000276499.1 immunity protein BlpZ -
  L1A15_RS02780 (L1A15_02780) - 526897..527508 (+) 612 WP_000394047.1 type II CAAX endopeptidase family protein -
  L1A15_RS02785 (L1A15_02785) - 527669..528463 (+) 795 WP_000363002.1 phosphotransferase family protein -
  L1A15_RS02790 (L1A15_02790) trmB 528460..529095 (+) 636 WP_001266080.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5150.86 Da        Isoelectric Point: 3.7098

>NTDB_id=645750 L1A15_RS02755 WP_001808912.1 524295..524444(+) (cipB) [Streptococcus pneumoniae strain MD5403]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=645750 L1A15_RS02755 WP_001808912.1 524295..524444(+) (cipB) [Streptococcus pneumoniae strain MD5403]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A4J1ZTW6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51