Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   LXM91_RS15015 Genome accession   NZ_CP090477
Coordinates   3035965..3036105 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain W0101     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3030965..3041105
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LXM91_RS14990 (LXM91_14990) - 3031305..3031688 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  LXM91_RS14995 (LXM91_14995) comA 3031710..3032354 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  LXM91_RS15000 (LXM91_15000) comP 3032435..3034726 (-) 2292 WP_039254056.1 histidine kinase Regulator
  LXM91_RS15005 (LXM91_15005) comX 3034738..3034902 (-) 165 WP_007613432.1 competence pheromone ComX -
  LXM91_RS15010 (LXM91_15010) - 3034902..3035813 (-) 912 WP_031378407.1 polyprenyl synthetase family protein -
  LXM91_RS15015 (LXM91_15015) degQ 3035965..3036105 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  LXM91_RS15020 (LXM91_15020) - 3036571..3036912 (+) 342 WP_014305721.1 hypothetical protein -
  LXM91_RS15025 (LXM91_15025) - 3036919..3038139 (-) 1221 WP_039254052.1 EAL and HDOD domain-containing protein -
  LXM91_RS15030 (LXM91_15030) - 3038269..3039735 (-) 1467 WP_099686880.1 nicotinate phosphoribosyltransferase -
  LXM91_RS15035 (LXM91_15035) - 3039753..3040304 (-) 552 WP_025853916.1 isochorismatase family cysteine hydrolase -
  LXM91_RS15040 (LXM91_15040) - 3040401..3040799 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=642724 LXM91_RS15015 WP_003152043.1 3035965..3036105(-) (degQ) [Bacillus amyloliquefaciens strain W0101]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=642724 LXM91_RS15015 WP_003152043.1 3035965..3036105(-) (degQ) [Bacillus amyloliquefaciens strain W0101]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891