Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   LXM91_RS12080 Genome accession   NZ_CP090477
Coordinates   2479557..2479994 (-) Length   145 a.a.
NCBI ID   WP_015417817.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain W0101     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2474557..2484994
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LXM91_RS12030 (LXM91_12030) sinI 2474941..2475114 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  LXM91_RS12035 (LXM91_12035) sinR 2475148..2475483 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LXM91_RS12040 (LXM91_12040) - 2475531..2476316 (-) 786 WP_007408329.1 TasA family protein -
  LXM91_RS12045 (LXM91_12045) - 2476381..2476965 (-) 585 WP_015240205.1 signal peptidase I -
  LXM91_RS12050 (LXM91_12050) tapA 2476937..2477608 (-) 672 WP_031378945.1 amyloid fiber anchoring/assembly protein TapA -
  LXM91_RS12055 (LXM91_12055) - 2477867..2478196 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  LXM91_RS12060 (LXM91_12060) - 2478236..2478415 (-) 180 WP_003153093.1 YqzE family protein -
  LXM91_RS12065 (LXM91_12065) comGG 2478472..2478849 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  LXM91_RS12070 (LXM91_12070) comGF 2478850..2479350 (-) 501 WP_257738552.1 competence type IV pilus minor pilin ComGF -
  LXM91_RS12075 (LXM91_12075) comGE 2479259..2479573 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  LXM91_RS12080 (LXM91_12080) comGD 2479557..2479994 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  LXM91_RS12085 (LXM91_12085) comGC 2479984..2480292 (-) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  LXM91_RS12090 (LXM91_12090) comGB 2480297..2481334 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  LXM91_RS12095 (LXM91_12095) comGA 2481321..2482391 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  LXM91_RS12100 (LXM91_12100) - 2482584..2483534 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -
  LXM91_RS12105 (LXM91_12105) - 2483680..2484981 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16226.70 Da        Isoelectric Point: 10.1850

>NTDB_id=642706 LXM91_RS12080 WP_015417817.1 2479557..2479994(-) (comGD) [Bacillus amyloliquefaciens strain W0101]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPACTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=642706 LXM91_RS12080 WP_015417817.1 2479557..2479994(-) (comGD) [Bacillus amyloliquefaciens strain W0101]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGTCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATCCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566