Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LXM91_RS12030 Genome accession   NZ_CP090477
Coordinates   2474941..2475114 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain W0101     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2469941..2480114
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LXM91_RS12015 (LXM91_12015) gcvT 2470754..2471854 (-) 1101 WP_031378949.1 glycine cleavage system aminomethyltransferase GcvT -
  LXM91_RS12020 (LXM91_12020) - 2472278..2473948 (+) 1671 WP_031378948.1 SNF2-related protein -
  LXM91_RS12025 (LXM91_12025) - 2473970..2474764 (+) 795 WP_007408330.1 YqhG family protein -
  LXM91_RS12030 (LXM91_12030) sinI 2474941..2475114 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  LXM91_RS12035 (LXM91_12035) sinR 2475148..2475483 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LXM91_RS12040 (LXM91_12040) - 2475531..2476316 (-) 786 WP_007408329.1 TasA family protein -
  LXM91_RS12045 (LXM91_12045) - 2476381..2476965 (-) 585 WP_015240205.1 signal peptidase I -
  LXM91_RS12050 (LXM91_12050) tapA 2476937..2477608 (-) 672 WP_031378945.1 amyloid fiber anchoring/assembly protein TapA -
  LXM91_RS12055 (LXM91_12055) - 2477867..2478196 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  LXM91_RS12060 (LXM91_12060) - 2478236..2478415 (-) 180 WP_003153093.1 YqzE family protein -
  LXM91_RS12065 (LXM91_12065) comGG 2478472..2478849 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  LXM91_RS12070 (LXM91_12070) comGF 2478850..2479350 (-) 501 WP_257738552.1 competence type IV pilus minor pilin ComGF -
  LXM91_RS12075 (LXM91_12075) comGE 2479259..2479573 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  LXM91_RS12080 (LXM91_12080) comGD 2479557..2479994 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=642703 LXM91_RS12030 WP_003153105.1 2474941..2475114(+) (sinI) [Bacillus amyloliquefaciens strain W0101]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=642703 LXM91_RS12030 WP_003153105.1 2474941..2475114(+) (sinI) [Bacillus amyloliquefaciens strain W0101]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702