Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   LUR16_RS12070 Genome accession   NZ_CP090475
Coordinates   2495895..2496407 (-) Length   170 a.a.
NCBI ID   WP_011276866.1    Uniprot ID   A0A5B2YXI2
Organism   Staphylococcus haemolyticus strain BC5211     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2440625..2501447 2495895..2496407 within 0


Gene organization within MGE regions


Location: 2440625..2501447
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LUR16_RS11790 - 2440625..2441197 (-) 573 WP_011276818.1 terminase small subunit -
  LUR16_RS11795 - 2441199..2441537 (-) 339 WP_011276819.1 helix-turn-helix transcriptional regulator -
  LUR16_RS11800 - 2441534..2441983 (-) 450 WP_011276820.1 hypothetical protein -
  LUR16_RS11805 - 2442038..2442190 (-) 153 WP_016931197.1 hypothetical protein -
  LUR16_RS11810 - 2442558..2443730 (+) 1173 WP_000195429.1 IS256-like element IS256 family transposase -
  LUR16_RS11815 - 2443782..2444805 (+) 1024 Protein_2288 SAP domain-containing protein -
  LUR16_RS11820 - 2444961..2445128 (+) 168 WP_011276824.1 hypothetical protein -
  LUR16_RS11825 - 2445962..2447176 (+) 1215 WP_011276827.1 tyrosine-type recombinase/integrase -
  LUR16_RS11830 guaA 2447342..2448883 (-) 1542 WP_011276828.1 glutamine-hydrolyzing GMP synthase -
  LUR16_RS11835 guaB 2449057..2450523 (-) 1467 WP_011276829.1 IMP dehydrogenase -
  LUR16_RS11840 pbuX 2450562..2451830 (-) 1269 WP_016931192.1 xanthine permease PbuX -
  LUR16_RS11845 xpt 2451827..2452408 (-) 582 WP_011276831.1 xanthine phosphoribosyltransferase -
  LUR16_RS11850 - 2452987..2453394 (+) 408 WP_011276832.1 general stress protein -
  LUR16_RS11855 - 2453542..2454210 (+) 669 WP_011276833.1 hypothetical protein -
  LUR16_RS11860 - 2454329..2454827 (+) 499 Protein_2297 DNA-binding protein -
  LUR16_RS11865 - 2455267..2456655 (+) 1389 WP_011276835.1 L-cystine transporter -
  LUR16_RS11870 nfsA 2456739..2457494 (-) 756 WP_016931190.1 oxygen-insensitive NADPH nitroreductase -
  LUR16_RS11875 - 2457652..2458431 (+) 780 WP_016931189.1 2-keto-4-pentenoate hydratase -
  LUR16_RS11880 ahpC 2458852..2459421 (+) 570 WP_011276838.1 alkyl hydroperoxide reductase subunit C -
  LUR16_RS11885 ahpF 2459436..2460959 (+) 1524 WP_016931188.1 alkyl hydroperoxide reductase subunit F -
  LUR16_RS11890 - 2461300..2461926 (+) 627 WP_016931187.1 NDxxF motif lipoprotein -
  LUR16_RS11895 - 2462026..2462604 (-) 579 WP_016931186.1 histidine phosphatase family protein -
  LUR16_RS11900 - 2462628..2463257 (-) 630 WP_016931185.1 LysE family translocator -
  LUR16_RS11905 - 2463704..2463937 (+) 234 WP_016931184.1 hypothetical protein -
  LUR16_RS11910 tnpA 2464074..2464556 (-) 483 WP_016931183.1 IS200/IS605-like element ISSep3 family transposase -
  LUR16_RS11915 - 2464657..2466321 (-) 1665 Protein_2308 IS1182 family transposase -
  LUR16_RS11920 - 2466688..2466825 (+) 138 WP_016931410.1 hypothetical protein -
  LUR16_RS11925 - 2466837..2467331 (+) 495 WP_016931411.1 TIGR01741 family protein -
  LUR16_RS11930 - 2467579..2468187 (-) 609 WP_016931412.1 recombinase family protein -
  LUR16_RS11935 - 2468557..2469402 (-) 846 WP_000733283.1 BlaZ family penicillin-hydrolyzing class A beta-lactamase PC1 -
  LUR16_RS11940 blaR1 2469509..2471266 (+) 1758 WP_001096374.1 beta-lactam sensor/signal transducer BlaR1 -
  LUR16_RS11945 blaI 2471256..2471636 (+) 381 WP_001284656.1 penicillinase repressor BlaI -
  LUR16_RS11950 - 2471900..2472493 (+) 594 WP_000690636.1 recombinase family protein -
  LUR16_RS11955 - 2472465..2473907 (+) 1443 WP_000790709.1 Mu transposase C-terminal domain-containing protein -
  LUR16_RS11960 - 2473900..2474715 (+) 816 WP_000160701.1 AAA family ATPase -
  LUR16_RS11965 - 2474862..2476634 (-) 1773 WP_016931413.1 RNA-directed DNA polymerase -
  LUR16_RS11970 - 2476770..2476871 (-) 102 WP_000228874.1 type I toxin-antitoxin system Fst family toxin -
  LUR16_RS11975 isaB 2477233..2477718 (-) 486 WP_011276857.1 immunodominant staphylococcal antigen IsaB family protein -
  LUR16_RS12505 - 2478056..2478166 (-) 111 WP_076690092.1 SE2200 family small protein -
  LUR16_RS11980 lqo 2478176..2479672 (-) 1497 WP_016931414.1 L-lactate dehydrogenase (quinone) -
  LUR16_RS11985 - 2480074..2481751 (+) 1678 Protein_2323 IS1182 family transposase -
  LUR16_RS11990 - 2481780..2482130 (-) 351 WP_016931403.1 winged helix-turn-helix transcriptional regulator -
  LUR16_RS11995 hxlA 2482233..2482868 (+) 636 WP_049426553.1 3-hexulose-6-phosphate synthase -
  LUR16_RS12000 - 2482957..2483475 (+) 519 WP_016931402.1 type 1 glutamine amidotransferase domain-containing protein -
  LUR16_RS12005 - 2483747..2484721 (-) 975 WP_029376696.1 cation diffusion facilitator family transporter -
  LUR16_RS12010 - 2484711..2485127 (-) 417 WP_016931400.1 DUF2231 domain-containing protein -
  LUR16_RS12015 - 2485203..2486345 (-) 1143 WP_049426552.1 sensor histidine kinase -
  LUR16_RS12020 - 2486345..2486992 (-) 648 WP_256262890.1 response regulator transcription factor -
  LUR16_RS12025 - 2487175..2487276 (-) 102 WP_016931398.1 type I toxin-antitoxin system Fst family toxin -
  LUR16_RS12030 - 2487957..2488415 (-) 459 WP_016931397.1 DUF1307 domain-containing protein -
  LUR16_RS12035 - 2489016..2490686 (-) 1671 WP_234573661.1 IS1182 family transposase -
  LUR16_RS12040 - 2491020..2492336 (+) 1317 WP_103416075.1 ISL3-like element ISSha1 family transposase -
  LUR16_RS12045 - 2492465..2492713 (-) 249 WP_011276862.1 GlsB/YeaQ/YmgE family stress response membrane protein -
  LUR16_RS12050 - 2492891..2493640 (-) 750 Protein_2336 amidohydrolase family protein -
  LUR16_RS12055 - 2493856..2494113 (+) 258 WP_011276864.1 hypothetical protein -
  LUR16_RS12060 - 2494316..2495386 (+) 1071 WP_011276865.1 Ltp family lipoprotein -
  LUR16_RS12065 rpsR 2495605..2495847 (-) 243 WP_002447994.1 30S ribosomal protein S18 -
  LUR16_RS12070 ssbA 2495895..2496407 (-) 513 WP_011276866.1 single-stranded DNA-binding protein Machinery gene
  LUR16_RS12075 rpsF 2496429..2496725 (-) 297 WP_011276867.1 30S ribosomal protein S6 -
  LUR16_RS12080 - 2497016..2497822 (+) 807 WP_011276868.1 glycoside hydrolase family 25 protein -
  LUR16_RS12085 - 2497888..2498079 (+) 192 WP_011276869.1 hypothetical protein -
  LUR16_RS12090 ychF 2498221..2499318 (-) 1098 WP_011276870.1 redox-regulated ATPase YchF -
  LUR16_RS12095 - 2499330..2499533 (-) 204 WP_011276871.1 DUF951 domain-containing protein -
  LUR16_RS12100 - 2499555..2500436 (-) 882 WP_049426415.1 mechanosensitive ion channel family protein -
  LUR16_RS12105 - 2500617..2501447 (-) 831 WP_053019364.1 ParB/RepB/Spo0J family partition protein -

Sequence

Protein


Download         Length: 170 a.a.        Molecular weight: 18837.38 Da        Isoelectric Point: 4.7306

>NTDB_id=642645 LUR16_RS12070 WP_011276866.1 2495895..2496407(-) (ssbA) [Staphylococcus haemolyticus strain BC5211]
MINRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINVVVFRRQAENVNNYLFKGSLAGVDGRIQSR
SYENQEGRRIFVTEVVADSVQFLEPKNAQGGQRNQSNNNDFQDYGQGFGGQQSGQNTSYNNNNSSNNKQSDNPFANANGP
IDISDDDLPF

Nucleotide


Download         Length: 513 bp        

>NTDB_id=642645 LUR16_RS12070 WP_011276866.1 2495895..2496407(-) (ssbA) [Staphylococcus haemolyticus strain BC5211]
ATGATAAACAGAGTTGTATTAGTAGGTCGTTTAACTAAAGATCCAGAATACAGAACCACTCCCTCAGGCGTAAGTGTAGC
GACATTTACTCTAGCAGTTAATCGTACTTTCACGAATGCTCAAGGGGAACGCGAAGCTGACTTCATCAATGTTGTTGTAT
TTAGAAGACAAGCAGAGAATGTGAATAATTATTTATTCAAAGGTAGTCTAGCTGGCGTTGATGGTCGCATACAATCACGC
AGTTATGAAAATCAAGAAGGTCGTCGTATCTTTGTTACTGAAGTTGTAGCAGATAGTGTTCAATTCCTTGAACCTAAAAA
TGCTCAAGGTGGCCAACGTAATCAAAGTAATAACAATGATTTCCAAGACTACGGTCAAGGATTTGGTGGTCAACAATCAG
GACAAAATACATCTTACAATAACAATAATTCATCAAATAATAAACAATCTGATAATCCATTTGCAAACGCAAACGGACCG
ATTGATATTAGTGATGATGACTTACCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5B2YXI2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

62.921

100

0.659
  ssb Latilactobacillus sakei subsp. sakei 23K

54.07

100

0.547
  ssbB Bacillus subtilis subsp. subtilis str. 168

60.377

62.353

0.376