Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | U722_RS11695 | Genome accession | NC_023073 |
| Coordinates | 2503804..2503977 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens LFB112 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2498804..2508977
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U722_RS11680 (U722_12465) | gcvT | 2499622..2500722 (-) | 1101 | WP_024085597.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| U722_RS11685 (U722_12470) | - | 2501145..2502815 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| U722_RS11690 (U722_12475) | - | 2502833..2503627 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| U722_RS11695 (U722_12480) | sinI | 2503804..2503977 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| U722_RS11700 (U722_12485) | sinR | 2504011..2504346 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| U722_RS11705 (U722_12490) | tasA | 2504394..2505179 (-) | 786 | WP_015388008.1 | biofilm matrix protein TasA | - |
| U722_RS11710 (U722_12495) | sipW | 2505243..2505827 (-) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| U722_RS11715 (U722_12500) | tapA | 2505799..2506470 (-) | 672 | WP_024085598.1 | amyloid fiber anchoring/assembly protein TapA | - |
| U722_RS11720 (U722_12505) | - | 2506730..2507059 (+) | 330 | WP_024085599.1 | DUF3889 domain-containing protein | - |
| U722_RS11725 (U722_12510) | - | 2507099..2507278 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| U722_RS11730 (U722_12515) | comGG | 2507335..2507712 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| U722_RS11735 (U722_12520) | comGF | 2507713..2508108 (-) | 396 | WP_003153090.1 | competence type IV pilus minor pilin ComGF | - |
| U722_RS11740 (U722_12525) | comGE | 2508122..2508436 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| U722_RS11745 (U722_12530) | comGD | 2508420..2508857 (-) | 438 | WP_024085600.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=64198 U722_RS11695 WP_003153105.1 2503804..2503977(+) (sinI) [Bacillus amyloliquefaciens LFB112]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=64198 U722_RS11695 WP_003153105.1 2503804..2503977(+) (sinI) [Bacillus amyloliquefaciens LFB112]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |