Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   LY257_RS07360 Genome accession   NZ_CP090367
Coordinates   1516756..1516869 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain CCUG 17875     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1511756..1521869
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LY257_RS07340 (LY257_07285) - 1512407..1513834 (-) 1428 WP_000694864.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  LY257_RS07345 (LY257_07290) comB10 1513904..1515034 (-) 1131 WP_001045886.1 DNA type IV secretion system protein ComB10 Machinery gene
  LY257_RS07350 (LY257_07295) comB9 1515027..1516022 (-) 996 WP_001864273.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  LY257_RS07355 (LY257_07300) comB8 1516022..1516759 (-) 738 WP_001208410.1 virB8 family protein Machinery gene
  LY257_RS07360 (LY257_07305) comB7 1516756..1516869 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  LY257_RS07365 (LY257_07310) comB6 1516885..1517940 (-) 1056 WP_000786653.1 P-type conjugative transfer protein TrbL Machinery gene
  LY257_RS07370 (LY257_07315) - 1517948..1518943 (-) 996 WP_000468494.1 PDZ domain-containing protein -
  LY257_RS07375 (LY257_07320) - 1518943..1519236 (-) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  LY257_RS07380 (LY257_07325) panD 1519247..1519597 (-) 351 WP_000142228.1 aspartate 1-decarboxylase -
  LY257_RS07385 (LY257_07330) - 1519587..1521812 (-) 2226 WP_001051484.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=641761 LY257_RS07360 WP_001217873.1 1516756..1516869(-) (comB7) [Helicobacter pylori strain CCUG 17875]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=641761 LY257_RS07360 WP_001217873.1 1516756..1516869(-) (comB7) [Helicobacter pylori strain CCUG 17875]
ATGAGGATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1