Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   LXN49_RS14675 Genome accession   NZ_CP090354
Coordinates   2883674..2883814 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain H31R-08     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2878674..2888814
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LXN49_RS14650 (LXN49_14650) - 2879008..2879397 (-) 390 WP_048237324.1 hotdog fold thioesterase -
  LXN49_RS14655 (LXN49_14655) comA 2879421..2880062 (-) 642 WP_048237325.1 response regulator transcription factor Regulator
  LXN49_RS14660 (LXN49_14660) comP 2880143..2882434 (-) 2292 WP_234107343.1 ATP-binding protein Regulator
  LXN49_RS14665 (LXN49_14665) comX 2882448..2882621 (-) 174 WP_024425944.1 competence pheromone ComX -
  LXN49_RS14670 (LXN49_14670) - 2882599..2883522 (-) 924 WP_234107344.1 polyprenyl synthetase family protein -
  LXN49_RS14675 (LXN49_14675) degQ 2883674..2883814 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  LXN49_RS14680 (LXN49_14680) - 2884320..2884676 (+) 357 WP_234107345.1 inner spore coat protein -
  LXN49_RS14685 (LXN49_14685) - 2884712..2885938 (-) 1227 WP_234107943.1 EAL and HDOD domain-containing protein -
  LXN49_RS14690 (LXN49_14690) - 2886076..2887548 (-) 1473 WP_048237329.1 nicotinate phosphoribosyltransferase -
  LXN49_RS14695 (LXN49_14695) - 2887566..2888117 (-) 552 WP_234107346.1 cysteine hydrolase family protein -
  LXN49_RS14700 (LXN49_14700) - 2888178..2888585 (-) 408 WP_048237331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=641616 LXN49_RS14675 WP_003213123.1 2883674..2883814(-) (degQ) [Bacillus safensis strain H31R-08]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=641616 LXN49_RS14675 WP_003213123.1 2883674..2883814(-) (degQ) [Bacillus safensis strain H31R-08]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696