Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   LXH20_RS11900 Genome accession   NZ_CP090150
Coordinates   2472691..2473005 (-) Length   104 a.a.
NCBI ID   WP_021494312.1    Uniprot ID   -
Organism   Bacillus velezensis strain BR-01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2467691..2478005
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LXH20_RS11855 (LXH20_11855) sinI 2468372..2468545 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  LXH20_RS11860 (LXH20_11860) sinR 2468579..2468914 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LXH20_RS11865 (LXH20_11865) tasA 2468962..2469747 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  LXH20_RS11870 (LXH20_11870) sipW 2469812..2470396 (-) 585 WP_022552967.1 signal peptidase I SipW -
  LXH20_RS11875 (LXH20_11875) tapA 2470368..2471039 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  LXH20_RS11880 (LXH20_11880) - 2471298..2471627 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  LXH20_RS11885 (LXH20_11885) - 2471668..2471847 (-) 180 WP_022552966.1 YqzE family protein -
  LXH20_RS11890 (LXH20_11890) comGG 2471904..2472281 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  LXH20_RS11895 (LXH20_11895) comGF 2472282..2472677 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  LXH20_RS11900 (LXH20_11900) comGE 2472691..2473005 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  LXH20_RS11905 (LXH20_11905) comGD 2472989..2473426 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  LXH20_RS11910 (LXH20_11910) comGC 2473416..2473724 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  LXH20_RS11915 (LXH20_11915) comGB 2473729..2474766 (-) 1038 WP_022552962.1 competence type IV pilus assembly protein ComGB Machinery gene
  LXH20_RS11920 (LXH20_11920) comGA 2474753..2475823 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  LXH20_RS11925 (LXH20_11925) - 2476016..2476966 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11803.81 Da        Isoelectric Point: 5.8181

>NTDB_id=640902 LXH20_RS11900 WP_021494312.1 2472691..2473005(-) (comGE) [Bacillus velezensis strain BR-01]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMMTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=640902 LXH20_RS11900 WP_021494312.1 2472691..2473005(-) (comGE) [Bacillus velezensis strain BR-01]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGATGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49