Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LXH20_RS11855 Genome accession   NZ_CP090150
Coordinates   2468372..2468545 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain BR-01     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2463372..2473545
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LXH20_RS11840 (LXH20_11840) gcvT 2464185..2465285 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  LXH20_RS11845 (LXH20_11845) - 2465709..2467379 (+) 1671 WP_038461530.1 DEAD/DEAH box helicase -
  LXH20_RS11850 (LXH20_11850) - 2467401..2468195 (+) 795 WP_014418368.1 YqhG family protein -
  LXH20_RS11855 (LXH20_11855) sinI 2468372..2468545 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  LXH20_RS11860 (LXH20_11860) sinR 2468579..2468914 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LXH20_RS11865 (LXH20_11865) tasA 2468962..2469747 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  LXH20_RS11870 (LXH20_11870) sipW 2469812..2470396 (-) 585 WP_022552967.1 signal peptidase I SipW -
  LXH20_RS11875 (LXH20_11875) tapA 2470368..2471039 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  LXH20_RS11880 (LXH20_11880) - 2471298..2471627 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  LXH20_RS11885 (LXH20_11885) - 2471668..2471847 (-) 180 WP_022552966.1 YqzE family protein -
  LXH20_RS11890 (LXH20_11890) comGG 2471904..2472281 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  LXH20_RS11895 (LXH20_11895) comGF 2472282..2472677 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  LXH20_RS11900 (LXH20_11900) comGE 2472691..2473005 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  LXH20_RS11905 (LXH20_11905) comGD 2472989..2473426 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=640899 LXH20_RS11855 WP_014418369.1 2468372..2468545(+) (sinI) [Bacillus velezensis strain BR-01]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=640899 LXH20_RS11855 WP_014418369.1 2468372..2468545(+) (sinI) [Bacillus velezensis strain BR-01]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719