Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   LXE94_RS16525 Genome accession   NZ_CP090125
Coordinates   3073367..3073507 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain Bs96     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3068367..3078507
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LXE94_RS16500 (LXE94_16460) yuxO 3068676..3069056 (-) 381 WP_217002947.1 hotdog fold thioesterase -
  LXE94_RS16505 (LXE94_16465) comA 3069075..3069719 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  LXE94_RS16510 (LXE94_16470) comP 3069800..3072109 (-) 2310 WP_257986178.1 two-component system sensor histidine kinase ComP Regulator
  LXE94_RS16515 (LXE94_16475) comX 3072128..3072295 (-) 168 WP_041057586.1 competence pheromone ComX Regulator
  LXE94_RS16520 (LXE94_16480) comQ 3072283..3073182 (-) 900 WP_038828674.1 class 1 isoprenoid biosynthesis enzyme Regulator
  LXE94_RS16525 (LXE94_16485) degQ 3073367..3073507 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  LXE94_RS16530 (LXE94_16490) - 3073729..3073854 (+) 126 WP_003228793.1 hypothetical protein -
  LXE94_RS16535 (LXE94_16495) - 3073968..3074342 (+) 375 WP_257986179.1 hypothetical protein -
  LXE94_RS16540 (LXE94_16500) pdeH 3074318..3075547 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  LXE94_RS16545 (LXE94_16505) pncB 3075684..3077156 (-) 1473 WP_041352162.1 nicotinate phosphoribosyltransferase -
  LXE94_RS16550 (LXE94_16510) pncA 3077172..3077723 (-) 552 WP_257986180.1 cysteine hydrolase family protein -
  LXE94_RS16555 (LXE94_16515) yueI 3077820..3078218 (-) 399 WP_085185940.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=640723 LXE94_RS16525 WP_003220708.1 3073367..3073507(-) (degQ) [Bacillus subtilis strain Bs96]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=640723 LXE94_RS16525 WP_003220708.1 3073367..3073507(-) (degQ) [Bacillus subtilis strain Bs96]
ATGGAAAAGAAACTCGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1