Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   U064_RS00195 Genome accession   NC_022911
Coordinates   37398..37511 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori BM012S     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32398..42511
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U064_RS00170 (U064_0034) - 32460..34685 (+) 2226 WP_023591490.1 AAA family ATPase -
  U064_RS00175 (U064_0035) panD 34675..35028 (+) 354 WP_023591491.1 aspartate 1-decarboxylase -
  U064_RS00180 (U064_0036) - 35031..35324 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  U064_RS00185 (U064_0037) - 35324..36319 (+) 996 WP_041200974.1 PDZ domain-containing protein -
  U064_RS00190 (U064_0038) comB6 36327..37382 (+) 1056 WP_023591493.1 P-type conjugative transfer protein TrbL Machinery gene
  U064_RS00195 (U064_0039) comB7 37398..37511 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  U064_RS00200 (U064_0040) comB8 37508..38251 (+) 744 WP_023591494.1 type IV secretion system protein Machinery gene
  U064_RS00205 (U064_0041) comB9 38251..39237 (+) 987 WP_041200975.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  U064_RS00210 (U064_0042) comB10 39230..40366 (+) 1137 WP_023591496.1 DNA type IV secretion system protein ComB10 Machinery gene
  U064_RS00215 (U064_0043) - 40437..41849 (+) 1413 WP_023591497.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=63839 U064_RS00195 WP_001217873.1 37398..37511(+) (comB7) [Helicobacter pylori BM012S]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=63839 U064_RS00195 WP_001217873.1 37398..37511(+) (comB7) [Helicobacter pylori BM012S]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment