Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   U712_RS11730 Genome accession   NC_022898
Coordinates   2370312..2370485 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis PY79     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2365312..2375485
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U712_RS11715 (U712_11995) gcvT 2366111..2367199 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  U712_RS11720 (U712_12000) hepAA 2367641..2369314 (+) 1674 WP_004398544.1 SNF2-related protein -
  U712_RS11725 (U712_12005) yqhG 2369335..2370129 (+) 795 WP_003230200.1 YqhG family protein -
  U712_RS11730 (U712_12010) sinI 2370312..2370485 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  U712_RS11735 (U712_12015) sinR 2370519..2370854 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  U712_RS11740 (U712_12020) tasA 2370947..2371732 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  U712_RS11745 (U712_12025) sipW 2371796..2372368 (-) 573 WP_003246088.1 signal peptidase I SipW -
  U712_RS11750 (U712_12030) tapA 2372352..2373113 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  U712_RS11755 (U712_12035) yqzG 2373385..2373711 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  U712_RS11760 (U712_12040) spoIITA 2373753..2373932 (-) 180 WP_003230176.1 YqzE family protein -
  U712_RS11765 (U712_12045) comGG 2374003..2374377 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  U712_RS11770 (U712_12050) comGF 2374378..2374761 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  U712_RS11775 (U712_12055) comGE 2374787..2375134 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=63749 U712_RS11730 WP_003230187.1 2370312..2370485(+) (sinI) [Bacillus subtilis PY79]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=63749 U712_RS11730 WP_003230187.1 2370312..2370485(+) (sinI) [Bacillus subtilis PY79]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment