Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   U712_RS11770 Genome accession   NC_022898
Coordinates   2374378..2374761 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis PY79     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2369378..2379761
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U712_RS11730 (U712_12010) sinI 2370312..2370485 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  U712_RS11735 (U712_12015) sinR 2370519..2370854 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  U712_RS11740 (U712_12020) tasA 2370947..2371732 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  U712_RS11745 (U712_12025) sipW 2371796..2372368 (-) 573 WP_003246088.1 signal peptidase I SipW -
  U712_RS11750 (U712_12030) tapA 2372352..2373113 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  U712_RS11755 (U712_12035) yqzG 2373385..2373711 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  U712_RS11760 (U712_12040) spoIITA 2373753..2373932 (-) 180 WP_003230176.1 YqzE family protein -
  U712_RS11765 (U712_12045) comGG 2374003..2374377 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  U712_RS11770 (U712_12050) comGF 2374378..2374761 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  U712_RS11775 (U712_12055) comGE 2374787..2375134 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  U712_RS11780 (U712_12060) comGD 2375118..2375549 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  U712_RS11785 (U712_12065) comGC 2375539..2375835 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  U712_RS11790 (U712_12070) comGB 2375849..2376886 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  U712_RS11795 (U712_12075) comGA 2376873..2377943 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  U712_RS11800 (U712_12085) corA 2378355..2379308 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=63752 U712_RS11770 WP_003230168.1 2374378..2374761(-) (comGF) [Bacillus subtilis PY79]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=63752 U712_RS11770 WP_003230168.1 2374378..2374761(-) (comGF) [Bacillus subtilis PY79]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment