Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LUX28_RS13020 Genome accession   NZ_CP089310
Coordinates   2636355..2636732 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain A4P130     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2631355..2641732
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LUX28_RS12980 (LUX28_12980) - 2631853..2632647 (+) 795 WP_007408330.1 YqhG family protein -
  LUX28_RS12985 (LUX28_12985) sinI 2632824..2632997 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LUX28_RS12990 (LUX28_12990) sinR 2633031..2633366 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LUX28_RS12995 (LUX28_12995) tasA 2633414..2634199 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  LUX28_RS13000 (LUX28_13000) sipW 2634264..2634848 (-) 585 WP_015240205.1 signal peptidase I SipW -
  LUX28_RS13005 (LUX28_13005) tapA 2634820..2635491 (-) 672 WP_053573199.1 amyloid fiber anchoring/assembly protein TapA -
  LUX28_RS13010 (LUX28_13010) - 2635750..2636079 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  LUX28_RS13015 (LUX28_13015) - 2636119..2636298 (-) 180 WP_003153093.1 YqzE family protein -
  LUX28_RS13020 (LUX28_13020) comGG 2636355..2636732 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  LUX28_RS13025 (LUX28_13025) comGF 2636733..2637233 (-) 501 WP_256052909.1 competence type IV pilus minor pilin ComGF -
  LUX28_RS13030 (LUX28_13030) comGE 2637142..2637456 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  LUX28_RS13035 (LUX28_13035) comGD 2637440..2637877 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  LUX28_RS13040 (LUX28_13040) comGC 2637867..2638175 (-) 309 WP_079979070.1 competence type IV pilus major pilin ComGC Machinery gene
  LUX28_RS13045 (LUX28_13045) comGB 2638180..2639217 (-) 1038 WP_053573197.1 competence type IV pilus assembly protein ComGB Machinery gene
  LUX28_RS13050 (LUX28_13050) comGA 2639204..2640274 (-) 1071 WP_053573196.1 competence type IV pilus ATPase ComGA Machinery gene
  LUX28_RS13055 (LUX28_13055) - 2640467..2641417 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=636404 LUX28_RS13020 WP_015417814.1 2636355..2636732(-) (comGG) [Bacillus velezensis strain A4P130]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=636404 LUX28_RS13020 WP_015417814.1 2636355..2636732(-) (comGG) [Bacillus velezensis strain A4P130]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAATACTGGATCGGAGAGAACTTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504