Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LUX28_RS12985 Genome accession   NZ_CP089310
Coordinates   2632824..2632997 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain A4P130     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2627824..2637997
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LUX28_RS12970 (LUX28_12970) gcvT 2628637..2629737 (-) 1101 WP_053573200.1 glycine cleavage system aminomethyltransferase GcvT -
  LUX28_RS12975 (LUX28_12975) - 2630161..2631831 (+) 1671 WP_031378948.1 DEAD/DEAH box helicase -
  LUX28_RS12980 (LUX28_12980) - 2631853..2632647 (+) 795 WP_007408330.1 YqhG family protein -
  LUX28_RS12985 (LUX28_12985) sinI 2632824..2632997 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LUX28_RS12990 (LUX28_12990) sinR 2633031..2633366 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LUX28_RS12995 (LUX28_12995) tasA 2633414..2634199 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  LUX28_RS13000 (LUX28_13000) sipW 2634264..2634848 (-) 585 WP_015240205.1 signal peptidase I SipW -
  LUX28_RS13005 (LUX28_13005) tapA 2634820..2635491 (-) 672 WP_053573199.1 amyloid fiber anchoring/assembly protein TapA -
  LUX28_RS13010 (LUX28_13010) - 2635750..2636079 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  LUX28_RS13015 (LUX28_13015) - 2636119..2636298 (-) 180 WP_003153093.1 YqzE family protein -
  LUX28_RS13020 (LUX28_13020) comGG 2636355..2636732 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  LUX28_RS13025 (LUX28_13025) comGF 2636733..2637233 (-) 501 WP_256052909.1 competence type IV pilus minor pilin ComGF -
  LUX28_RS13030 (LUX28_13030) comGE 2637142..2637456 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  LUX28_RS13035 (LUX28_13035) comGD 2637440..2637877 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=636402 LUX28_RS12985 WP_003153105.1 2632824..2632997(+) (sinI) [Bacillus velezensis strain A4P130]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=636402 LUX28_RS12985 WP_003153105.1 2632824..2632997(+) (sinI) [Bacillus velezensis strain A4P130]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702