Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | LUX28_RS12985 | Genome accession | NZ_CP089310 |
| Coordinates | 2632824..2632997 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain A4P130 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2627824..2637997
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LUX28_RS12970 (LUX28_12970) | gcvT | 2628637..2629737 (-) | 1101 | WP_053573200.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| LUX28_RS12975 (LUX28_12975) | - | 2630161..2631831 (+) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| LUX28_RS12980 (LUX28_12980) | - | 2631853..2632647 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| LUX28_RS12985 (LUX28_12985) | sinI | 2632824..2632997 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| LUX28_RS12990 (LUX28_12990) | sinR | 2633031..2633366 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| LUX28_RS12995 (LUX28_12995) | tasA | 2633414..2634199 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| LUX28_RS13000 (LUX28_13000) | sipW | 2634264..2634848 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| LUX28_RS13005 (LUX28_13005) | tapA | 2634820..2635491 (-) | 672 | WP_053573199.1 | amyloid fiber anchoring/assembly protein TapA | - |
| LUX28_RS13010 (LUX28_13010) | - | 2635750..2636079 (+) | 330 | WP_039254490.1 | DUF3889 domain-containing protein | - |
| LUX28_RS13015 (LUX28_13015) | - | 2636119..2636298 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| LUX28_RS13020 (LUX28_13020) | comGG | 2636355..2636732 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LUX28_RS13025 (LUX28_13025) | comGF | 2636733..2637233 (-) | 501 | WP_256052909.1 | competence type IV pilus minor pilin ComGF | - |
| LUX28_RS13030 (LUX28_13030) | comGE | 2637142..2637456 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| LUX28_RS13035 (LUX28_13035) | comGD | 2637440..2637877 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=636402 LUX28_RS12985 WP_003153105.1 2632824..2632997(+) (sinI) [Bacillus velezensis strain A4P130]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=636402 LUX28_RS12985 WP_003153105.1 2632824..2632997(+) (sinI) [Bacillus velezensis strain A4P130]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |