Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LQF30_RS01440 | Genome accession | NZ_CP088002 |
| Coordinates | 279132..279641 (+) | Length | 169 a.a. |
| NCBI ID | WP_145356214.1 | Uniprot ID | - |
| Organism | Staphylococcus epidermidis strain IVK83 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 266695..309090 | 279132..279641 | within | 0 |
Gene organization within MGE regions
Location: 266695..309090
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQF30_RS01355 (LQF30_01355) | - | 266695..267036 (+) | 342 | WP_049376948.1 | DUF1450 domain-containing protein | - |
| LQF30_RS01360 (LQF30_01360) | merA | 267490..268692 (-) | 1203 | Protein_252 | hypothiocyanous acid reductase MerA | - |
| LQF30_RS01370 (LQF30_01370) | - | 268719..270094 (-) | 1376 | Protein_253 | recombinase family protein | - |
| LQF30_RS01375 (LQF30_01375) | - | 270245..270892 (-) | 648 | WP_145356227.1 | hypothetical protein | - |
| LQF30_RS01380 (LQF30_01380) | - | 271100..272239 (-) | 1140 | WP_145356225.1 | CapA family protein | - |
| LQF30_RS01385 (LQF30_01385) | - | 272285..272749 (-) | 465 | WP_049367112.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LQF30_RS01390 (LQF30_01390) | - | 272764..273096 (-) | 333 | WP_049367114.1 | helix-turn-helix domain-containing protein | - |
| LQF30_RS01395 (LQF30_01395) | - | 273272..273517 (+) | 246 | WP_049367116.1 | helix-turn-helix transcriptional regulator | - |
| LQF30_RS01400 (LQF30_01400) | - | 273547..274293 (+) | 747 | WP_103483034.1 | phage antirepressor KilAC domain-containing protein | - |
| LQF30_RS01405 (LQF30_01405) | - | 274335..274568 (+) | 234 | WP_145356223.1 | MW1434 family type I TA system toxin | - |
| LQF30_RS01410 (LQF30_01410) | - | 274554..274892 (-) | 339 | WP_002499261.1 | hypothetical protein | - |
| LQF30_RS01415 (LQF30_01415) | - | 275042..275218 (+) | 177 | WP_186297894.1 | hypothetical protein | - |
| LQF30_RS01420 (LQF30_01420) | - | 275281..275544 (+) | 264 | WP_145356221.1 | hypothetical protein | - |
| LQF30_RS01425 (LQF30_01425) | - | 275547..277496 (+) | 1950 | WP_145356219.1 | AAA family ATPase | - |
| LQF30_RS01430 (LQF30_01430) | - | 277498..278433 (+) | 936 | WP_145356217.1 | recombinase RecT | - |
| LQF30_RS01435 (LQF30_01435) | - | 278502..279131 (+) | 630 | WP_263928715.1 | MBL fold metallo-hydrolase | - |
| LQF30_RS01440 (LQF30_01440) | ssbA | 279132..279641 (+) | 510 | WP_145356214.1 | single-stranded DNA-binding protein | Machinery gene |
| LQF30_RS01445 (LQF30_01445) | - | 279748..280491 (+) | 744 | WP_263927715.1 | DnaD domain-containing protein | - |
| LQF30_RS01450 (LQF30_01450) | - | 280510..280737 (+) | 228 | WP_103483030.1 | DUF3269 family protein | - |
| LQF30_RS01455 (LQF30_01455) | - | 280747..281154 (+) | 408 | WP_103483029.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LQF30_RS01460 (LQF30_01460) | - | 281195..281701 (+) | 507 | WP_064600190.1 | dUTPase | - |
| LQF30_RS01465 (LQF30_01465) | - | 281667..281822 (+) | 156 | WP_263927716.1 | hypothetical protein | - |
| LQF30_RS01470 (LQF30_01470) | - | 281873..282175 (-) | 303 | WP_064600193.1 | DUF4870 domain-containing protein | - |
| LQF30_RS01475 (LQF30_01475) | rinB | 282280..282456 (+) | 177 | WP_145356212.1 | transcriptional activator RinB | - |
| LQF30_RS12140 | - | 282464..282613 (+) | 150 | WP_002499243.1 | DUF1514 domain-containing protein | - |
| LQF30_RS01480 (LQF30_01480) | - | 282630..283076 (+) | 447 | WP_263927717.1 | transcriptional regulator | - |
| LQF30_RS01485 (LQF30_01485) | - | 283661..284011 (+) | 351 | WP_017464444.1 | HNH endonuclease | - |
| LQF30_RS01490 (LQF30_01490) | - | 284154..284624 (+) | 471 | WP_002497599.1 | phage terminase small subunit P27 family | - |
| LQF30_RS01495 (LQF30_01495) | - | 284617..286368 (+) | 1752 | WP_145356210.1 | terminase large subunit | - |
| LQF30_RS12085 | - | 286384..286578 (+) | 195 | WP_145356208.1 | hypothetical protein | - |
| LQF30_RS01500 (LQF30_01500) | - | 286578..287810 (+) | 1233 | WP_145356206.1 | phage portal protein | - |
| LQF30_RS01505 (LQF30_01505) | - | 287800..288357 (+) | 558 | WP_064600201.1 | HK97 family phage prohead protease | - |
| LQF30_RS01510 (LQF30_01510) | - | 288399..289748 (+) | 1350 | WP_145356204.1 | phage major capsid protein | - |
| LQF30_RS01515 (LQF30_01515) | - | 289767..290108 (+) | 342 | WP_145356202.1 | head-tail connector protein | - |
| LQF30_RS01520 (LQF30_01520) | - | 290098..290427 (+) | 330 | WP_002468167.1 | hypothetical protein | - |
| LQF30_RS01525 (LQF30_01525) | - | 290424..290828 (+) | 405 | WP_145356200.1 | hypothetical protein | - |
| LQF30_RS01530 (LQF30_01530) | - | 290833..291234 (+) | 402 | WP_145356198.1 | hypothetical protein | - |
| LQF30_RS01535 (LQF30_01535) | - | 291249..291785 (+) | 537 | WP_222114610.1 | HNH endonuclease | - |
| LQF30_RS01540 (LQF30_01540) | - | 291846..292472 (+) | 627 | WP_263927718.1 | major tail protein | - |
| LQF30_RS01545 (LQF30_01545) | - | 292491..292676 (+) | 186 | WP_049367138.1 | hypothetical protein | - |
| LQF30_RS01550 (LQF30_01550) | gpG | 292740..293102 (+) | 363 | WP_002502067.1 | phage tail assembly chaperone G | - |
| LQF30_RS01555 (LQF30_01555) | gpGT | 293135..293287 (+) | 153 | WP_186297892.1 | phage tail assembly chaperone GT | - |
| LQF30_RS01560 (LQF30_01560) | - | 293316..297812 (+) | 4497 | WP_263927719.1 | tape measure protein | - |
| LQF30_RS01565 (LQF30_01565) | - | 297814..298647 (+) | 834 | WP_002502070.1 | phage tail domain-containing protein | - |
| LQF30_RS01570 (LQF30_01570) | - | 298657..300216 (+) | 1560 | WP_186297891.1 | prophage endopeptidase tail family protein | - |
| LQF30_RS01575 (LQF30_01575) | - | 300209..300382 (+) | 174 | WP_017464458.1 | hypothetical protein | - |
| LQF30_RS01580 (LQF30_01580) | - | 300398..302260 (+) | 1863 | WP_145356192.1 | M14 family metallopeptidase | - |
| LQF30_RS01585 (LQF30_01585) | - | 302260..303474 (+) | 1215 | WP_263927720.1 | BppU family phage baseplate upper protein | - |
| LQF30_RS01590 (LQF30_01590) | - | 303479..304102 (+) | 624 | WP_263927721.1 | poly-gamma-glutamate hydrolase family protein | - |
| LQF30_RS01595 (LQF30_01595) | - | 304099..304524 (+) | 426 | WP_145356186.1 | hypothetical protein | - |
| LQF30_RS01600 (LQF30_01600) | - | 304511..304918 (+) | 408 | WP_145356185.1 | hypothetical protein | - |
| LQF30_RS01605 (LQF30_01605) | - | 305076..305474 (+) | 399 | WP_032606342.1 | YxeA family protein | - |
| LQF30_RS01610 (LQF30_01610) | - | 305538..306017 (+) | 480 | WP_145356183.1 | phage holin | - |
| LQF30_RS01615 (LQF30_01615) | - | 306281..307642 (+) | 1362 | WP_145356179.1 | hypothetical protein | - |
| LQF30_RS01620 (LQF30_01620) | - | 307738..309090 (+) | 1353 | Protein_305 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 169 a.a. Molecular weight: 18754.34 Da Isoelectric Point: 5.2048
>NTDB_id=632250 LQF30_RS01440 WP_145356214.1 279132..279641(+) (ssbA) [Staphylococcus epidermidis strain IVK83]
MINRVVLVGRLTKDPEFRTTQSGIDVATFTLAVNRNFTNAQGEREADFINIIVFRKQAHNVNDYLSKGKLAGVDGRIQSR
SYENQEGRRIFVTEVVADSVQFLEPKNAQQGGQRSQNNNFQDYGQGFGGQQSGQNTSYNNNNSSNSNQSDNPFANANGPI
NISDDDLPF
MINRVVLVGRLTKDPEFRTTQSGIDVATFTLAVNRNFTNAQGEREADFINIIVFRKQAHNVNDYLSKGKLAGVDGRIQSR
SYENQEGRRIFVTEVVADSVQFLEPKNAQQGGQRSQNNNFQDYGQGFGGQQSGQNTSYNNNNSSNSNQSDNPFANANGPI
NISDDDLPF
Nucleotide
Download Length: 510 bp
>NTDB_id=632250 LQF30_RS01440 WP_145356214.1 279132..279641(+) (ssbA) [Staphylococcus epidermidis strain IVK83]
ATGATTAACAGAGTCGTATTAGTAGGTCGTTTAACTAAAGATCCTGAATTTAGAACAACTCAAAGTGGAATTGATGTTGC
AACTTTCACACTAGCAGTTAATCGTAATTTCACAAACGCACAGGGCGAACGTGAAGCAGATTTTATCAATATTATCGTAT
TTAGAAAACAAGCACACAATGTTAACGACTATTTATCGAAAGGAAAATTAGCAGGCGTTGATGGTCGAATTCAATCACGC
AGTTATGAAAATCAAGAAGGTCGTCGAATATTTGTGACTGAAGTAGTTGCAGATAGCGTTCAATTTCTTGAACCTAAAAA
CGCACAACAAGGTGGCCAACGTTCACAGAACAATAATTTTCAAGACTACGGTCAAGGATTTGGTGGTCAGCAATCAGGAC
AAAATACATCTTACAACAACAATAATTCATCAAACTCAAATCAGTCGGATAACCCGTTTGCAAATGCTAATGGACCGATT
AATATCAGTGATGATGATTTACCATTTTAA
ATGATTAACAGAGTCGTATTAGTAGGTCGTTTAACTAAAGATCCTGAATTTAGAACAACTCAAAGTGGAATTGATGTTGC
AACTTTCACACTAGCAGTTAATCGTAATTTCACAAACGCACAGGGCGAACGTGAAGCAGATTTTATCAATATTATCGTAT
TTAGAAAACAAGCACACAATGTTAACGACTATTTATCGAAAGGAAAATTAGCAGGCGTTGATGGTCGAATTCAATCACGC
AGTTATGAAAATCAAGAAGGTCGTCGAATATTTGTGACTGAAGTAGTTGCAGATAGCGTTCAATTTCTTGAACCTAAAAA
CGCACAACAAGGTGGCCAACGTTCACAGAACAATAATTTTCAAGACTACGGTCAAGGATTTGGTGGTCAGCAATCAGGAC
AAAATACATCTTACAACAACAATAATTCATCAAACTCAAATCAGTCGGATAACCCGTTTGCAAATGCTAATGGACCGATT
AATATCAGTGATGATGATTTACCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.551 |
100 |
0.627 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.448 |
100 |
0.55 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.25 |
66.272 |
0.373 |