Detailed information NTG0631068

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: LP473_RS10770
• Genome accession: NZ_CP087699
• Coordinates: 2155522..2155953 (-)
• Length: 143 a.a.
• NCBI ID: WP_080585155.1
• Uniprot ID: -
• Organism: Lactococcus lactis subsp. lactis strain IBB417
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2150522..2160953

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LP473_RS10730 (LP473_10735)	-	2150527..2151393 (+)	867	WP_153927515.1	RluA family pseudouridine synthase	-
LP473_RS10735 (LP473_10740)	-	2151432..2152241 (-)	810	WP_014570791.1	metal ABC transporter permease	-
LP473_RS10740 (LP473_10745)	-	2152234..2152971 (-)	738	WP_058221575.1	metal ABC transporter ATP-binding protein	-
LP473_RS10745 (LP473_10750)	-	2153148..2153990 (-)	843	WP_003129990.1	metal ABC transporter substrate-binding protein	-
LP473_RS10750 (LP473_10755)	-	2153987..2154424 (-)	438	WP_003129992.1	zinc-dependent MarR family transcriptional regulator	-
LP473_RS10755 (LP473_10760)	comGG	2154522..2154806 (-)	285	WP_003129993.1	competence type IV pilus minor pilin ComGG	Machinery gene
LP473_RS10760 (LP473_10765)	comGF	2154845..2155291 (-)	447	WP_029344525.1	competence type IV pilus minor pilin ComGF	Machinery gene
LP473_RS10765 (LP473_10770)	comGE	2155254..2155550 (-)	297	WP_010906316.1	competence type IV pilus minor pilin ComGE	Machinery gene
LP473_RS10770 (LP473_10775)	comGD	2155522..2155953 (-)	432	WP_080585155.1	competence type IV pilus minor pilin ComGD	Machinery gene
LP473_RS10775 (LP473_10780)	comGC	2155913..2156182 (-)	270	WP_003129998.1	competence type IV pilus major pilin ComGC	Machinery gene
LP473_RS10780 (LP473_10785)	-	2156288..2157007 (-)	720	WP_095345449.1	hypothetical protein	-
LP473_RS10785 (LP473_10790)	-	2157087..2157866 (-)	780	WP_252174746.1	peptidoglycan amidohydrolase family protein	-
LP473_RS10790 (LP473_10795)	-	2157866..2158165 (-)	300	WP_252174747.1	phage holin	-
LP473_RS10795 (LP473_10800)	-	2158178..2158528 (-)	351	WP_014570798.1	hypothetical protein	-
LP473_RS10800 (LP473_10805)	-	2158541..2158777 (-)	237	WP_081196280.1	hypothetical protein	-
LP473_RS10805 (LP473_10810)	-	2158789..2160567 (-)	1779	WP_252174748.1	hypothetical protein	-
LP473_RS10810 (LP473_10815)	-	2160545..2160718 (-)	174	WP_252174749.1	hypothetical protein	-

Sequence

Protein

• Length: 143 a.a.
• Molecular weight: 16534.53 Da
• Isoelectric Point: 9.6891

>NTDB_id=631068 LP473_RS10770 WP_080585155.1 2155522..2155953(-) (comGD) [Lactococcus lactis subsp. lactis strain IBB417]
MIRTKMKNEILMTRAFTLLESLLVLLIISFITTLFSLEIIQTVHLFKGELFVLQFENFYKRSQEDAALLQKSESLVAKNQ
ELICEDRSITIPKEVAVKDFTVKFDDKGGNSSLQKLTIFLPYEKKFITYQLEIGSGKFKKKIS

Nucleotide

• Length: 432 bp

>NTDB_id=631068 LP473_RS10770 WP_080585155.1 2155522..2155953(-) (comGD) [Lactococcus lactis subsp. lactis strain IBB417]
ATGATCAGAACAAAAATGAAGAACGAAATTTTAATGACTAGAGCATTTACTTTACTAGAGTCTCTTCTAGTTTTGTTGAT
TATTTCTTTTATCACAACTCTTTTTTCTTTAGAAATAATACAAACAGTCCATCTTTTTAAGGGAGAACTGTTTGTTCTCC
AGTTTGAAAATTTCTATAAAAGGAGTCAAGAAGATGCTGCACTGCTTCAAAAATCTGAAAGTTTAGTTGCTAAAAATCAA
GAATTAATCTGTGAAGATAGAAGTATCACAATTCCAAAGGAGGTAGCAGTTAAAGATTTTACAGTTAAATTTGATGATAA
GGGAGGGAATTCTAGCTTACAAAAACTCACAATTTTTTTACCTTACGAAAAAAAGTTCATCACTTATCAATTGGAGATAG
GCAGTGGAAAATTTAAAAAGAAAATCAGTTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Lactococcus lactis subsp. cremoris KW2	66.434	100	0.664
comYD	Streptococcus gordonii str. Challis substr. CH1	39.716	98.601	0.392
comYD	Streptococcus mutans UA140	40.625	89.51	0.364
comYD	Streptococcus mutans UA159	40.625	89.51	0.364