Detailed information    

insolico Bioinformatically predicted

Overview

Name   crp   Type   Regulator
Locus tag   LOZ89_RS06020 Genome accession   NZ_CP087594
Coordinates   1266049..1266756 (-) Length   235 a.a.
NCBI ID   WP_000203217.1    Uniprot ID   -
Organism   Acinetobacter baumannii strain SHOU-Ab01     
Function   regulate competence development (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1215429..1268886 1266049..1266756 within 0


Gene organization within MGE regions


Location: 1215429..1268886
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LOZ89_RS05695 (LOZ89_05695) - 1216890..1217447 (-) 558 WP_001111768.1 cytochrome b -
  LOZ89_RS05700 (LOZ89_05700) - 1217689..1218078 (+) 390 WP_000735756.1 hypothetical protein -
  LOZ89_RS05705 (LOZ89_05705) rnhB 1218144..1218710 (+) 567 WP_000495836.1 ribonuclease HII -
  LOZ89_RS05710 (LOZ89_05710) csrA 1218780..1219034 (-) 255 WP_000906487.1 carbon storage regulator CsrA -
  LOZ89_RS05715 (LOZ89_05715) - 1219281..1220561 (-) 1281 WP_001185176.1 aspartate kinase -
  LOZ89_RS05720 (LOZ89_05720) - 1220771..1220986 (-) 216 WP_000362184.1 hypothetical protein -
  LOZ89_RS05725 (LOZ89_05725) - 1220988..1221245 (-) 258 WP_031981110.1 hypothetical protein -
  LOZ89_RS05730 (LOZ89_05730) - 1221249..1221533 (-) 285 WP_000048750.1 hypothetical protein -
  LOZ89_RS05735 (LOZ89_05735) - 1221530..1221739 (-) 210 WP_000453808.1 hypothetical protein -
  LOZ89_RS05740 (LOZ89_05740) - 1221742..1221987 (-) 246 WP_000654849.1 hypothetical protein -
  LOZ89_RS05745 (LOZ89_05745) - 1221989..1223065 (-) 1077 WP_033523606.1 hypothetical protein -
  LOZ89_RS05750 (LOZ89_05750) - 1223080..1223847 (-) 768 WP_002055023.1 hypothetical protein -
  LOZ89_RS05755 (LOZ89_05755) - 1223859..1224182 (-) 324 WP_000148665.1 hypothetical protein -
  LOZ89_RS05760 (LOZ89_05760) - 1224185..1224625 (-) 441 WP_057691842.1 hypothetical protein -
  LOZ89_RS05765 (LOZ89_05765) - 1224812..1225054 (+) 243 WP_000051959.1 hypothetical protein -
  LOZ89_RS05770 (LOZ89_05770) - 1225061..1225264 (-) 204 WP_000845537.1 hypothetical protein -
  LOZ89_RS05775 (LOZ89_05775) - 1225400..1225933 (-) 534 WP_000590883.1 DUF4411 family protein -
  LOZ89_RS05780 (LOZ89_05780) - 1225936..1227057 (-) 1122 WP_032027783.1 ImmA/IrrE family metallo-endopeptidase -
  LOZ89_RS05785 (LOZ89_05785) - 1227214..1227429 (-) 216 WP_000370485.1 hypothetical protein -
  LOZ89_RS05790 (LOZ89_05790) - 1227444..1228208 (-) 765 WP_000792745.1 LexA family transcriptional regulator -
  LOZ89_RS05795 (LOZ89_05795) - 1228286..1228471 (+) 186 WP_000165919.1 Cro/CI family transcriptional regulator -
  LOZ89_RS05800 (LOZ89_05800) - 1228481..1228837 (+) 357 WP_000041063.1 hypothetical protein -
  LOZ89_RS05805 (LOZ89_05805) - 1228893..1229168 (+) 276 WP_001095601.1 hypothetical protein -
  LOZ89_RS05810 (LOZ89_05810) - 1229165..1229461 (+) 297 WP_001084140.1 hypothetical protein -
  LOZ89_RS05815 (LOZ89_05815) - 1229458..1229820 (+) 363 WP_001267985.1 hypothetical protein -
  LOZ89_RS05820 (LOZ89_05820) - 1229813..1230742 (+) 930 WP_000280078.1 YdaU family protein -
  LOZ89_RS05825 (LOZ89_05825) - 1230735..1231484 (+) 750 WP_230258725.1 hypothetical protein -
  LOZ89_RS05830 (LOZ89_05830) - 1231481..1231936 (+) 456 WP_005124477.1 hypothetical protein -
  LOZ89_RS05835 (LOZ89_05835) - 1231936..1232331 (+) 396 WP_002066642.1 DUF559 domain-containing protein -
  LOZ89_RS05840 (LOZ89_05840) - 1232328..1232828 (+) 501 WP_230258726.1 hypothetical protein -
  LOZ89_RS05845 (LOZ89_05845) - 1232943..1233578 (+) 636 WP_000890354.1 hypothetical protein -
  LOZ89_RS05850 (LOZ89_05850) - 1233639..1233857 (+) 219 WP_212285813.1 hypothetical protein -
  LOZ89_RS05855 (LOZ89_05855) - 1233978..1234412 (+) 435 WP_000215490.1 hypothetical protein -
  LOZ89_RS05860 (LOZ89_05860) - 1234457..1235104 (+) 648 WP_230258727.1 putative metallopeptidase -
  LOZ89_RS05865 (LOZ89_05865) - 1235152..1235631 (+) 480 WP_046267440.1 DUF2280 domain-containing protein -
  LOZ89_RS05870 (LOZ89_05870) terL 1235621..1237048 (+) 1428 WP_115435008.1 phage terminase large subunit -
  LOZ89_RS05875 (LOZ89_05875) - 1237045..1238496 (+) 1452 WP_230258728.1 DUF4055 domain-containing protein -
  LOZ89_RS05880 (LOZ89_05880) - 1238498..1239601 (+) 1104 WP_033855665.1 minor capsid protein -
  LOZ89_RS05885 (LOZ89_05885) - 1239610..1240038 (+) 429 WP_000965231.1 hypothetical protein -
  LOZ89_RS05890 (LOZ89_05890) - 1240137..1240373 (+) 237 WP_000004365.1 hypothetical protein -
  LOZ89_RS05895 (LOZ89_05895) - 1240596..1240787 (+) 192 WP_001139861.1 hypothetical protein -
  LOZ89_RS05900 (LOZ89_05900) - 1240900..1241667 (+) 768 WP_230258729.1 DUF6651 domain-containing protein -
  LOZ89_RS05905 (LOZ89_05905) - 1241695..1241802 (+) 108 Protein_1137 major capsid protein -
  LOZ89_RS05910 (LOZ89_05910) - 1242111..1242293 (+) 183 WP_000838147.1 type II toxin-antitoxin system HicA family toxin -
  LOZ89_RS05915 (LOZ89_05915) - 1242358..1242762 (+) 405 WP_000966690.1 type II toxin-antitoxin system HicB family antitoxin -
  LOZ89_RS05920 (LOZ89_05920) - 1242861..1243037 (+) 177 WP_001983384.1 hypothetical protein -
  LOZ89_RS05925 (LOZ89_05925) - 1243046..1243369 (+) 324 WP_000523922.1 DUF4236 domain-containing protein -
  LOZ89_RS05930 (LOZ89_05930) - 1243403..1243936 (+) 534 WP_000719143.1 hypothetical protein -
  LOZ89_RS05935 (LOZ89_05935) - 1243948..1244349 (+) 402 WP_000758222.1 J517_1871 family lipoprotein -
  LOZ89_RS05940 (LOZ89_05940) - 1244408..1248583 (+) 4176 WP_230258730.1 tape measure protein -
  LOZ89_RS05945 (LOZ89_05945) - 1248778..1249260 (+) 483 WP_114212242.1 hypothetical protein -
  LOZ89_RS05950 (LOZ89_05950) - 1249280..1249540 (-) 261 WP_000124482.1 Arc family DNA-binding protein -
  LOZ89_RS05955 (LOZ89_05955) - 1249706..1250605 (+) 900 WP_000096283.1 Bro-N domain-containing protein -
  LOZ89_RS05960 (LOZ89_05960) - 1250944..1251489 (+) 546 WP_053502695.1 glycoside hydrolase family 108 protein -
  LOZ89_RS05965 (LOZ89_05965) - 1251731..1252222 (+) 492 WP_005802707.1 hypothetical protein -
  LOZ89_RS05970 (LOZ89_05970) - 1252343..1253116 (-) 774 WP_001066070.1 membrane protein -
  LOZ89_RS05975 (LOZ89_05975) - 1253295..1254941 (+) 1647 WP_230258731.1 phosphoethanolamine transferase -
  LOZ89_RS05980 (LOZ89_05980) - 1255200..1256402 (-) 1203 WP_049069257.1 tyrosine-type recombinase/integrase -
  LOZ89_RS05985 (LOZ89_05985) alaS 1256689..1259325 (-) 2637 WP_000199457.1 alanine--tRNA ligase -
  LOZ89_RS05990 (LOZ89_05990) - 1259595..1260620 (+) 1026 WP_005129105.1 type I glyceraldehyde-3-phosphate dehydrogenase -
  LOZ89_RS05995 (LOZ89_05995) - 1260896..1262062 (+) 1167 WP_000155680.1 ATP phosphoribosyltransferase regulatory subunit -
  LOZ89_RS06000 (LOZ89_06000) - 1262127..1263446 (+) 1320 WP_005129103.1 adenylosuccinate synthase -
  LOZ89_RS06005 (LOZ89_06005) - 1263568..1263885 (+) 318 WP_000776215.1 hypothetical protein -
  LOZ89_RS06010 (LOZ89_06010) - 1264002..1264781 (+) 780 WP_001034598.1 M48 family metallopeptidase -
  LOZ89_RS06015 (LOZ89_06015) - 1264839..1265888 (-) 1050 WP_005129100.1 NADP(H)-dependent aldo-keto reductase -
  LOZ89_RS06020 (LOZ89_06020) crp 1266049..1266756 (-) 708 WP_000203217.1 cAMP-activated global transcriptional regulator CRP Regulator
  LOZ89_RS06025 (LOZ89_06025) - 1266997..1267116 (+) 120 Protein_1161 hypothetical protein -
  LOZ89_RS06030 (LOZ89_06030) - 1267195..1267617 (+) 423 WP_001195082.1 OsmC family protein -
  LOZ89_RS06035 (LOZ89_06035) - 1267712..1268137 (+) 426 WP_001026228.1 GNAT family N-acetyltransferase -

Sequence

Protein


Download         Length: 235 a.a.        Molecular weight: 26567.18 Da        Isoelectric Point: 4.6625

>NTDB_id=630307 LOZ89_RS06020 WP_000203217.1 1266049..1266756(-) (crp) [Acinetobacter baumannii strain SHOU-Ab01]
MTSNFSQLSTDALSPGQLPESVKALLKRAHINRYPKRTTIVDAGTESKSLYLILKGSVSIILREDDEREIVVAYLNPGDF
FGEMGLFEPNPQRTAEVRTRDVCEIAEISYDNFHELSKQYPDLSYAVFAQLVRRLKNTTRKMTDLAFIDVSGRIARCLID
LSSQPEAMILPNGRQIRITRQEIGRIVGCSREMVGRVLKTLEDQGMIQTDGKAILIFDTSLEETPVTDEDYDDEE

Nucleotide


Download         Length: 708 bp        

>NTDB_id=630307 LOZ89_RS06020 WP_000203217.1 1266049..1266756(-) (crp) [Acinetobacter baumannii strain SHOU-Ab01]
ATGACTTCAAATTTTTCACAACTCAGCACAGATGCTTTATCTCCGGGGCAACTACCTGAATCCGTTAAAGCATTGTTAAA
ACGTGCTCACATCAACAGATATCCAAAACGAACCACAATTGTTGATGCCGGAACAGAGTCAAAATCTTTATATTTAATTT
TAAAAGGCTCAGTTTCAATTATTTTACGTGAAGACGATGAACGTGAAATTGTTGTGGCATATTTGAATCCTGGTGACTTC
TTTGGGGAAATGGGGCTTTTCGAACCGAACCCTCAACGTACAGCTGAAGTTCGTACCCGTGATGTCTGTGAAATTGCAGA
AATTTCATATGACAACTTCCACGAACTGAGCAAACAGTATCCAGATCTCAGCTATGCCGTTTTCGCGCAACTCGTTCGTC
GTTTAAAAAATACAACTCGTAAAATGACCGATCTTGCATTTATTGATGTGTCAGGTCGTATTGCGCGTTGCTTAATCGAC
CTATCTTCACAACCAGAAGCAATGATCTTGCCGAATGGCCGTCAAATTCGTATTACTCGACAAGAGATTGGACGCATTGT
CGGGTGTTCACGAGAAATGGTTGGCCGTGTATTAAAGACCTTAGAAGATCAAGGTATGATTCAAACTGACGGTAAAGCTA
TTCTAATTTTTGATACTTCATTAGAAGAAACCCCAGTCACTGACGAAGACTATGATGACGAAGAATAA

Domains

Predicted by InterproScan.

Crp-like helix-turn-helix domain (HTH_Crp_2)

(152-218)

Cyclic nucleotide-binding domain (cNMP_binding)

(33-120)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  crp Acinetobacter baumannii D1279779

99.574

100

0.996
  crp Vibrio cholerae strain A1552

47.343

88.085

0.417
  crp Haemophilus influenzae Rd KW20

48.705

82.128

0.4