Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   LM507_RS11040 Genome accession   NZ_CP086726
Coordinates   2299298..2299825 (+) Length   175 a.a.
NCBI ID   WP_229022085.1    Uniprot ID   -
Organism   Enterococcus faecalis strain E533     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2287611..2329986 2299298..2299825 within 0


Gene organization within MGE regions


Location: 2287611..2329986
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LM507_RS10945 (LM507_10945) glyA 2287611..2288849 (+) 1239 WP_002356623.1 serine hydroxymethyltransferase -
  LM507_RS10950 (LM507_10950) upp 2288981..2289610 (+) 630 WP_002356624.1 uracil phosphoribosyltransferase -
  LM507_RS10955 (LM507_10955) - 2289716..2289988 (+) 273 WP_010820195.1 SemiSWEET family transporter -
  LM507_RS10960 (LM507_10960) - 2290062..2290298 (-) 237 WP_002381528.1 hypothetical protein -
  LM507_RS10970 (LM507_10970) - 2290654..2291823 (-) 1170 WP_033600913.1 tyrosine-type recombinase/integrase -
  LM507_RS10975 (LM507_10975) - 2291937..2292551 (-) 615 WP_033600914.1 SHOCT domain-containing protein -
  LM507_RS10980 (LM507_10980) - 2292565..2293299 (-) 735 WP_141893361.1 DUF4950 domain-containing protein -
  LM507_RS10985 (LM507_10985) - 2293387..2293809 (-) 423 WP_141893359.1 ImmA/IrrE family metallo-endopeptidase -
  LM507_RS10990 (LM507_10990) - 2293810..2294151 (-) 342 WP_141893357.1 helix-turn-helix domain-containing protein -
  LM507_RS10995 (LM507_10995) - 2294440..2294631 (+) 192 WP_002371609.1 hypothetical protein -
  LM507_RS11000 (LM507_11000) - 2294643..2294924 (+) 282 WP_141893355.1 excisionase -
  LM507_RS11005 (LM507_11005) - 2294878..2295591 (+) 714 WP_229963211.1 Rha family transcriptional regulator -
  LM507_RS11010 (LM507_11010) - 2295602..2295787 (+) 186 WP_002364665.1 hypothetical protein -
  LM507_RS11015 (LM507_11015) - 2295799..2295972 (+) 174 WP_002364664.1 hypothetical protein -
  LM507_RS15225 - 2296172..2296294 (+) 123 WP_002399179.1 hypothetical protein -
  LM507_RS11020 (LM507_11020) - 2296278..2296757 (+) 480 WP_229022086.1 siphovirus Gp157 family protein -
  LM507_RS11025 (LM507_11025) - 2296769..2297785 (+) 1017 WP_002381629.1 AAA family ATPase -
  LM507_RS11030 (LM507_11030) - 2297790..2298431 (+) 642 WP_085345089.1 putative HNHc nuclease -
  LM507_RS11035 (LM507_11035) - 2298451..2299293 (+) 843 WP_229022141.1 DNA replication protein -
  LM507_RS11040 (LM507_11040) ssb 2299298..2299825 (+) 528 WP_229022085.1 single-stranded DNA-binding protein Machinery gene
  LM507_RS11045 (LM507_11045) - 2299837..2300166 (+) 330 WP_174098288.1 hypothetical protein -
  LM507_RS11050 (LM507_11050) - 2300186..2300392 (+) 207 WP_002395701.1 hypothetical protein -
  LM507_RS11055 (LM507_11055) - 2300519..2301682 (+) 1164 WP_412030885.1 N-6 DNA methylase -
  LM507_RS11060 (LM507_11060) - 2301675..2302631 (+) 957 WP_010730060.1 site-specific integrase -
  LM507_RS11065 (LM507_11065) - 2302650..2303156 (+) 507 WP_010783692.1 hypothetical protein -
  LM507_RS11070 (LM507_11070) - 2303426..2303932 (+) 507 WP_229022083.1 hypothetical protein -
  LM507_RS11075 (LM507_11075) - 2303933..2304259 (+) 327 WP_229022082.1 hypothetical protein -
  LM507_RS11080 (LM507_11080) - 2304259..2304483 (+) 225 WP_229022081.1 hypothetical protein -
  LM507_RS11085 (LM507_11085) - 2304509..2304832 (+) 324 WP_229022080.1 DNA-directed RNA polymerase subunit delta -
  LM507_RS11090 (LM507_11090) - 2304829..2305131 (+) 303 WP_174125860.1 hypothetical protein -
  LM507_RS11095 (LM507_11095) - 2305143..2305391 (+) 249 WP_229022079.1 hypothetical protein -
  LM507_RS11100 (LM507_11100) - 2305403..2305888 (+) 486 WP_137278656.1 hypothetical protein -
  LM507_RS11105 (LM507_11105) - 2305885..2306202 (+) 318 WP_137278657.1 replicase -
  LM507_RS11110 (LM507_11110) - 2306196..2306387 (+) 192 WP_229022078.1 hypothetical protein -
  LM507_RS11115 (LM507_11115) - 2306388..2306807 (+) 420 WP_002404562.1 transcriptional regulator -
  LM507_RS11120 (LM507_11120) - 2307081..2307803 (+) 723 WP_229022077.1 hypothetical protein -
  LM507_RS11125 (LM507_11125) - 2307915..2308115 (+) 201 WP_229963276.1 hypothetical protein -
  LM507_RS11130 (LM507_11130) - 2308169..2308630 (+) 462 WP_002405234.1 terminase small subunit -
  LM507_RS11135 (LM507_11135) - 2308620..2309894 (+) 1275 WP_142960529.1 PBSX family phage terminase large subunit -
  LM507_RS11140 (LM507_11140) - 2309907..2311382 (+) 1476 WP_229022076.1 phage portal protein -
  LM507_RS11145 (LM507_11145) - 2311357..2312403 (+) 1047 WP_229022075.1 phage head morphogenesis protein -
  LM507_RS11150 (LM507_11150) - 2312406..2312726 (+) 321 WP_104681295.1 hypothetical protein -
  LM507_RS11155 (LM507_11155) - 2312945..2313574 (+) 630 WP_142959624.1 DUF4355 domain-containing protein -
  LM507_RS11160 (LM507_11160) - 2313588..2314490 (+) 903 WP_016634610.1 DUF5309 family protein -
  LM507_RS11165 (LM507_11165) - 2314514..2314750 (+) 237 WP_002402418.1 hypothetical protein -
  LM507_RS11170 (LM507_11170) - 2314759..2315103 (+) 345 WP_002402417.1 hypothetical protein -
  LM507_RS11175 (LM507_11175) - 2315100..2315477 (+) 378 WP_002402416.1 hypothetical protein -
  LM507_RS11180 (LM507_11180) - 2315470..2315868 (+) 399 WP_002402415.1 HK97 gp10 family phage protein -
  LM507_RS11185 (LM507_11185) - 2315872..2316246 (+) 375 WP_229022074.1 DUF6838 family protein -
  LM507_RS11190 (LM507_11190) - 2316247..2317089 (+) 843 WP_113847605.1 major tail protein -
  LM507_RS11195 (LM507_11195) gpG 2317142..2317495 (+) 354 WP_002364485.1 phage tail assembly chaperone G -
  LM507_RS11200 (LM507_11200) - 2317744..2320641 (+) 2898 WP_229022140.1 tape measure protein -
  LM507_RS11205 (LM507_11205) - 2320631..2321365 (+) 735 WP_229022073.1 phage tail protein -
  LM507_RS11210 (LM507_11210) - 2321347..2324061 (+) 2715 WP_229022072.1 phage tail spike protein -
  LM507_RS11215 (LM507_11215) - 2324076..2324984 (+) 909 WP_202236682.1 phage baseplate upper protein -
  LM507_RS11220 (LM507_11220) - 2324977..2325294 (+) 318 WP_010783717.1 hypothetical protein -
  LM507_RS11225 (LM507_11225) - 2325287..2325604 (+) 318 WP_002385669.1 hypothetical protein -
  LM507_RS11230 (LM507_11230) - 2325604..2326113 (+) 510 WP_002394069.1 hypothetical protein -
  LM507_RS11235 (LM507_11235) - 2326130..2326504 (+) 375 WP_010783718.1 hypothetical protein -
  LM507_RS11240 (LM507_11240) - 2326504..2326641 (+) 138 WP_002399193.1 XkdX family protein -
  LM507_RS11245 (LM507_11245) - 2326675..2326908 (+) 234 WP_002383824.1 hemolysin XhlA family protein -
  LM507_RS11250 (LM507_11250) - 2326911..2327123 (+) 213 WP_010783719.1 phage holin -
  LM507_RS11255 (LM507_11255) - 2327120..2328379 (+) 1260 WP_229963212.1 LysM peptidoglycan-binding domain-containing protein -
  LM507_RS11265 (LM507_11265) - 2328583..2329326 (-) 744 WP_229022070.1 hypothetical protein -
  LM507_RS11270 (LM507_11270) - 2329660..2329986 (-) 327 WP_002362235.1 AzlD domain-containing protein -

Sequence


Protein


Download         Length: 175 a.a.        Molecular weight: 19339.24 Da        Isoelectric Point: 4.7078

>NTDB_id=626158 LM507_RS11040 WP_229022085.1 2299298..2299825(+) (ssb) [Enterococcus faecalis strain E533]
MINQVVLVGRLTKDIDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLEPKSANENRNSIQSSQNSVTGVQNNFESNYATNQNKGLNQQNNSQQMSFGGDVDPFA
GAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=626158 LM507_RS11040 WP_229022085.1 2299298..2299825(+) (ssb) [Enterococcus faecalis strain E533]
ATGATAAACCAAGTTGTGTTAGTTGGACGTTTAACGAAAGATATAGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGTAAAGGAACATTATTAGGAGTTGTTGGCAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTGTTTGCGAGAGTTTCCAATTATTAGAGCCAAAAAG
CGCCAATGAGAATAGAAATAGCATTCAGAGTTCACAGAATAGCGTTACAGGCGTTCAAAATAATTTCGAGAGTAATTATG
CCACGAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTAGATCCGTTTGCA
GGTGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCTTTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

58.989

100

0.6

  ssbA Bacillus subtilis subsp. subtilis str. 168

58.989

100

0.6

  ssbB Bacillus subtilis subsp. subtilis str. 168

60.377

60.571

0.366