Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LMJ46_RS04555 | Genome accession | NZ_CP086411 |
| Coordinates | 898071..898598 (+) | Length | 175 a.a. |
| NCBI ID | WP_010708003.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis strain R5 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 890322..930586 | 898071..898598 | within | 0 |
Gene organization within MGE regions
Location: 890322..930586
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LMJ46_RS04485 (LMJ46_04485) | - | 890322..891485 (-) | 1164 | WP_002406293.1 | tyrosine-type recombinase/integrase | - |
| LMJ46_RS04490 (LMJ46_04490) | - | 891488..891727 (-) | 240 | WP_229018013.1 | hypothetical protein | - |
| LMJ46_RS04495 (LMJ46_04495) | - | 891729..891968 (-) | 240 | WP_002395685.1 | hypothetical protein | - |
| LMJ46_RS04500 (LMJ46_04500) | - | 892032..892460 (-) | 429 | WP_229018014.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LMJ46_RS04505 (LMJ46_04505) | - | 892475..892864 (-) | 390 | WP_002406296.1 | helix-turn-helix domain-containing protein | - |
| LMJ46_RS04510 (LMJ46_04510) | - | 893156..893356 (+) | 201 | WP_010818747.1 | helix-turn-helix domain-containing protein | - |
| LMJ46_RS04515 (LMJ46_04515) | - | 893360..893644 (+) | 285 | WP_002406299.1 | hypothetical protein | - |
| LMJ46_RS04520 (LMJ46_04520) | - | 893659..894372 (+) | 714 | WP_002406300.1 | Rha family transcriptional regulator | - |
| LMJ46_RS04525 (LMJ46_04525) | - | 894383..894568 (+) | 186 | WP_002357337.1 | hypothetical protein | - |
| LMJ46_RS04530 (LMJ46_04530) | - | 894580..894753 (+) | 174 | WP_010822888.1 | hypothetical protein | - |
| LMJ46_RS14885 | - | 894952..895074 (+) | 123 | WP_002414628.1 | hypothetical protein | - |
| LMJ46_RS04535 (LMJ46_04535) | - | 895058..895537 (+) | 480 | WP_002381628.1 | siphovirus Gp157 family protein | - |
| LMJ46_RS04540 (LMJ46_04540) | - | 895549..896565 (+) | 1017 | WP_002365157.1 | AAA family ATPase | - |
| LMJ46_RS04545 (LMJ46_04545) | - | 896570..897211 (+) | 642 | WP_002414632.1 | putative HNHc nuclease | - |
| LMJ46_RS04550 (LMJ46_04550) | - | 897215..898066 (+) | 852 | WP_010708002.1 | helix-turn-helix domain-containing protein | - |
| LMJ46_RS04555 (LMJ46_04555) | ssb | 898071..898598 (+) | 528 | WP_010708003.1 | single-stranded DNA-binding protein | Machinery gene |
| LMJ46_RS04560 (LMJ46_04560) | - | 898675..898938 (+) | 264 | WP_229018015.1 | hypothetical protein | - |
| LMJ46_RS04565 (LMJ46_04565) | - | 898958..899164 (+) | 207 | WP_173963012.1 | hypothetical protein | - |
| LMJ46_RS04570 (LMJ46_04570) | - | 899217..899870 (+) | 654 | WP_229018016.1 | N-6 DNA methylase | - |
| LMJ46_RS04575 (LMJ46_04575) | - | 899867..900810 (+) | 944 | Protein_885 | site-specific integrase | - |
| LMJ46_RS04580 (LMJ46_04580) | - | 900823..901386 (+) | 564 | WP_085390721.1 | hypothetical protein | - |
| LMJ46_RS04585 (LMJ46_04585) | - | 901379..901699 (+) | 321 | WP_025188083.1 | hypothetical protein | - |
| LMJ46_RS04590 (LMJ46_04590) | - | 901720..902031 (+) | 312 | WP_002393129.1 | hypothetical protein | - |
| LMJ46_RS04595 (LMJ46_04595) | - | 902065..902472 (+) | 408 | WP_085390469.1 | YopX family protein | - |
| LMJ46_RS04600 (LMJ46_04600) | - | 902454..902648 (+) | 195 | WP_085390468.1 | hypothetical protein | - |
| LMJ46_RS04605 (LMJ46_04605) | - | 902859..903107 (+) | 249 | WP_142430265.1 | hypothetical protein | - |
| LMJ46_RS04610 (LMJ46_04610) | - | 903119..903352 (+) | 234 | WP_142429471.1 | hypothetical protein | - |
| LMJ46_RS04615 (LMJ46_04615) | - | 903349..903897 (+) | 549 | WP_142430264.1 | DUF3850 domain-containing protein | - |
| LMJ46_RS04620 (LMJ46_04620) | - | 903911..904396 (+) | 486 | WP_002389003.1 | hypothetical protein | - |
| LMJ46_RS04625 (LMJ46_04625) | - | 904397..904579 (+) | 183 | WP_002389222.1 | hypothetical protein | - |
| LMJ46_RS04630 (LMJ46_04630) | - | 904762..904962 (+) | 201 | WP_010710727.1 | hypothetical protein | - |
| LMJ46_RS04635 (LMJ46_04635) | - | 905352..905768 (+) | 417 | WP_002357362.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LMJ46_RS04640 (LMJ46_04640) | - | 906042..906305 (+) | 264 | WP_002357363.1 | hypothetical protein | - |
| LMJ46_RS04645 (LMJ46_04645) | - | 906341..906478 (-) | 138 | WP_010773976.1 | zinc ribbon-containing protein | - |
| LMJ46_RS04655 (LMJ46_04655) | - | 907523..907747 (+) | 225 | WP_229018017.1 | hypothetical protein | - |
| LMJ46_RS04660 (LMJ46_04660) | terS | 907800..908594 (+) | 795 | WP_002406140.1 | phage terminase small subunit | - |
| LMJ46_RS04665 (LMJ46_04665) | - | 908566..909870 (+) | 1305 | WP_002406139.1 | PBSX family phage terminase large subunit | - |
| LMJ46_RS04670 (LMJ46_04670) | - | 909884..911311 (+) | 1428 | WP_010815133.1 | phage portal protein | - |
| LMJ46_RS04675 (LMJ46_04675) | - | 911292..911603 (+) | 312 | WP_002406137.1 | ribosomal-processing cysteine protease Prp | - |
| LMJ46_RS04680 (LMJ46_04680) | - | 911604..912752 (+) | 1149 | WP_002406136.1 | minor capsid protein | - |
| LMJ46_RS04685 (LMJ46_04685) | - | 912749..912979 (+) | 231 | WP_002406135.1 | hypothetical protein | - |
| LMJ46_RS04690 (LMJ46_04690) | - | 913266..913916 (+) | 651 | WP_010818755.1 | DUF4355 domain-containing protein | - |
| LMJ46_RS04695 (LMJ46_04695) | - | 913932..914969 (+) | 1038 | WP_002406133.1 | major capsid protein | - |
| LMJ46_RS04700 (LMJ46_04700) | - | 914983..915321 (+) | 339 | WP_002415688.1 | phage head-tail connector protein | - |
| LMJ46_RS04705 (LMJ46_04705) | - | 915302..915643 (+) | 342 | WP_002406131.1 | hypothetical protein | - |
| LMJ46_RS04710 (LMJ46_04710) | - | 915643..916182 (+) | 540 | WP_002406129.1 | hypothetical protein | - |
| LMJ46_RS04715 (LMJ46_04715) | - | 916179..916541 (+) | 363 | WP_002406128.1 | hypothetical protein | - |
| LMJ46_RS04720 (LMJ46_04720) | - | 916561..917019 (+) | 459 | WP_010815137.1 | hypothetical protein | - |
| LMJ46_RS04725 (LMJ46_04725) | - | 917076..917486 (+) | 411 | WP_002406126.1 | DUF6096 family protein | - |
| LMJ46_RS04730 (LMJ46_04730) | - | 917519..917878 (+) | 360 | WP_002406125.1 | hypothetical protein | - |
| LMJ46_RS04735 (LMJ46_04735) | - | 917888..922423 (+) | 4536 | WP_142430261.1 | transglycosylase SLT domain-containing protein | - |
| LMJ46_RS04740 (LMJ46_04740) | - | 922434..922799 (+) | 366 | WP_010821551.1 | DUF6711 family protein | - |
| LMJ46_RS04745 (LMJ46_04745) | - | 922816..925230 (+) | 2415 | WP_142430260.1 | gp58-like family protein | - |
| LMJ46_RS14890 | - | 925250..925378 (+) | 129 | WP_256968977.1 | hypothetical protein | - |
| LMJ46_RS04750 (LMJ46_04750) | - | 925390..926511 (+) | 1122 | WP_142430259.1 | pyocin knob domain-containing protein | - |
| LMJ46_RS04755 (LMJ46_04755) | - | 926585..926806 (+) | 222 | WP_002374005.1 | hypothetical protein | - |
| LMJ46_RS04760 (LMJ46_04760) | - | 926799..927035 (+) | 237 | WP_002411209.1 | phage holin | - |
| LMJ46_RS04765 (LMJ46_04765) | - | 927032..928117 (+) | 1086 | WP_174121974.1 | SH3 domain-containing protein | - |
| LMJ46_RS04770 (LMJ46_04770) | - | 928510..929043 (+) | 534 | WP_002402066.1 | PBECR4 domain-containing protein | - |
| LMJ46_RS04780 (LMJ46_04780) | - | 929261..929746 (+) | 486 | WP_229018018.1 | hypothetical protein | - |
| LMJ46_RS04785 (LMJ46_04785) | - | 930011..930586 (-) | 576 | WP_010818758.1 | SHOCT domain-containing protein | - |
Sequence
Protein
Download Length: 175 a.a. Molecular weight: 19373.26 Da Isoelectric Point: 4.7078
>NTDB_id=624823 LMJ46_RS04555 WP_010708003.1 898071..898598(+) (ssb) [Enterococcus faecalis strain R5]
MINQVVLVGRLTKDIDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVICESFQLLESKSTNENRNSIQSSQNSVTGVQNNFESNYATNQNKGLNQQNNSQQMSFGGDVDPFA
GAGNSIDISDDDLPF
MINQVVLVGRLTKDIDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVICESFQLLESKSTNENRNSIQSSQNSVTGVQNNFESNYATNQNKGLNQQNNSQQMSFGGDVDPFA
GAGNSIDISDDDLPF
Nucleotide
Download Length: 528 bp
>NTDB_id=624823 LMJ46_RS04555 WP_010708003.1 898071..898598(+) (ssb) [Enterococcus faecalis strain R5]
ATGATAAACCAAGTTGTGTTAGTTGGACGTTTAACGAAAGATATAGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGTAAAGGAACATTATTAGGAGTTGTTGGCAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTATTTGCGAGAGTTTCCAATTATTAGAGTCAAAAAG
CACCAACGAGAATAGAAATAGCATTCAGAGTTCGCAGAATAGCGTTACAGGCGTTCAAAATAATTTTGAGAGTAATTATG
CCACAAATCAAAATAAAGGCTTAAATCAACAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGCGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCTTTTTAG
ATGATAAACCAAGTTGTGTTAGTTGGACGTTTAACGAAAGATATAGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGTAAAGGAACATTATTAGGAGTTGTTGGCAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTATTTGCGAGAGTTTCCAATTATTAGAGTCAAAAAG
CACCAACGAGAATAGAAATAGCATTCAGAGTTCGCAGAATAGCGTTACAGGCGTTCAAAATAATTTTGAGAGTAATTATG
CCACAAATCAAAATAAAGGCTTAAATCAACAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGCGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCTTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
59.551 |
100 |
0.606 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.427 |
100 |
0.594 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
60.571 |
0.36 |