Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   LMJ46_RS00370 Genome accession   NZ_CP086411
Coordinates   75975..76502 (+) Length   175 a.a.
NCBI ID   WP_010826244.1    Uniprot ID   -
Organism   Enterococcus faecalis strain R5     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 66486..104829 75975..76502 within 0


Gene organization within MGE regions


Location: 66486..104829
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LMJ46_RS00285 (LMJ46_00285) - 66486..67835 (-) 1350 WP_002411357.1 recombinase family protein -
  LMJ46_RS00290 (LMJ46_00290) - 67864..68046 (-) 183 WP_002411356.1 hypothetical protein -
  LMJ46_RS00295 (LMJ46_00295) - 68211..68927 (-) 717 WP_229017980.1 XRE family transcriptional regulator -
  LMJ46_RS00300 (LMJ46_00300) - 69073..69279 (+) 207 WP_002411354.1 helix-turn-helix domain-containing protein -
  LMJ46_RS00305 (LMJ46_00305) - 69317..69478 (+) 162 WP_002411353.1 hypothetical protein -
  LMJ46_RS00310 (LMJ46_00310) - 69536..69706 (+) 171 WP_002357333.1 hypothetical protein -
  LMJ46_RS00315 (LMJ46_00315) - 69700..69921 (-) 222 WP_229018025.1 hypothetical protein -
  LMJ46_RS00320 (LMJ46_00320) - 69989..70204 (+) 216 WP_002357335.1 hypothetical protein -
  LMJ46_RS00325 (LMJ46_00325) - 70473..71183 (+) 711 WP_187166539.1 Rha family transcriptional regulator -
  LMJ46_RS00330 (LMJ46_00330) - 71194..71379 (+) 186 WP_002364665.1 hypothetical protein -
  LMJ46_RS00335 (LMJ46_00335) - 71391..71567 (+) 177 WP_010711635.1 hypothetical protein -
  LMJ46_RS00340 (LMJ46_00340) - 71707..72267 (-) 561 WP_064687099.1 hypothetical protein -
  LMJ46_RS00345 (LMJ46_00345) - 72552..73295 (+) 744 WP_010708942.1 ERF family protein -
  LMJ46_RS00350 (LMJ46_00350) - 73295..74233 (+) 939 WP_010783683.1 DUF1351 domain-containing protein -
  LMJ46_RS00355 (LMJ46_00355) - 74230..74871 (+) 642 WP_229017981.1 putative HNHc nuclease -
  LMJ46_RS00360 (LMJ46_00360) - 74875..75672 (+) 798 WP_010784194.1 helix-turn-helix domain-containing protein -
  LMJ46_RS00365 (LMJ46_00365) - 75677..75985 (+) 309 WP_010822654.1 MazG-like family protein -
  LMJ46_RS00370 (LMJ46_00370) ssb 75975..76502 (+) 528 WP_010826244.1 single-stranded DNA-binding protein Machinery gene
  LMJ46_RS00375 (LMJ46_00375) - 76515..76844 (+) 330 WP_049097668.1 hypothetical protein -
  LMJ46_RS00380 (LMJ46_00380) - 76864..77070 (+) 207 WP_002395701.1 hypothetical protein -
  LMJ46_RS00385 (LMJ46_00385) - 77123..77863 (+) 741 WP_002410993.1 hypothetical protein -
  LMJ46_RS00390 (LMJ46_00390) - 77881..78555 (+) 675 WP_229017982.1 N-6 DNA methylase -
  LMJ46_RS00395 (LMJ46_00395) - 78569..79513 (+) 945 WP_229017983.1 site-specific integrase -
  LMJ46_RS00400 (LMJ46_00400) - 79526..80098 (+) 573 WP_229017984.1 hypothetical protein -
  LMJ46_RS00405 (LMJ46_00405) - 80082..80462 (+) 381 WP_010731652.1 YopX family protein -
  LMJ46_RS00410 (LMJ46_00410) - 80463..80795 (+) 333 WP_229017985.1 hypothetical protein -
  LMJ46_RS00415 (LMJ46_00415) - 80796..81074 (+) 279 WP_229017986.1 hypothetical protein -
  LMJ46_RS00420 (LMJ46_00420) - 81086..81382 (+) 297 WP_192190748.1 DNA-directed RNA polymerase subunit delta -
  LMJ46_RS00425 (LMJ46_00425) - 81414..81773 (+) 360 WP_192190749.1 hypothetical protein -
  LMJ46_RS00430 (LMJ46_00430) - 81766..82275 (+) 510 WP_229017987.1 DUF1642 domain-containing protein -
  LMJ46_RS00435 (LMJ46_00435) - 82458..82658 (+) 201 WP_324251477.1 hypothetical protein -
  LMJ46_RS00440 (LMJ46_00440) - 82803..83219 (+) 417 WP_010711654.1 ArpU family phage packaging/lysis transcriptional regulator -
  LMJ46_RS00450 (LMJ46_00450) - 84285..85118 (+) 834 WP_010784197.1 terminase small subunit -
  LMJ46_RS00455 (LMJ46_00455) - 85108..86397 (+) 1290 WP_002411228.1 PBSX family phage terminase large subunit -
  LMJ46_RS00460 (LMJ46_00460) - 86413..87912 (+) 1500 WP_002357369.1 phage portal protein -
  LMJ46_RS00465 (LMJ46_00465) - 87912..89069 (+) 1158 WP_002411227.1 phage minor capsid protein -
  LMJ46_RS00470 (LMJ46_00470) - 89121..89309 (+) 189 WP_002357372.1 hypothetical protein -
  LMJ46_RS00475 (LMJ46_00475) - 89405..89959 (+) 555 WP_010826285.1 phage scaffolding protein -
  LMJ46_RS00480 (LMJ46_00480) - 89976..90842 (+) 867 WP_002357374.1 hypothetical protein -
  LMJ46_RS00485 (LMJ46_00485) - 90940..91344 (+) 405 WP_002411223.1 hypothetical protein -
  LMJ46_RS00490 (LMJ46_00490) - 91338..91679 (+) 342 WP_002411222.1 putative minor capsid protein -
  LMJ46_RS00495 (LMJ46_00495) - 91679..92005 (+) 327 WP_002411221.1 minor capsid protein -
  LMJ46_RS00500 (LMJ46_00500) - 92005..92403 (+) 399 WP_002411220.1 minor capsid protein -
  LMJ46_RS00505 (LMJ46_00505) - 92403..92882 (+) 480 WP_010826287.1 phage tail tube protein -
  LMJ46_RS00510 (LMJ46_00510) - 92953..93405 (+) 453 WP_010784203.1 hypothetical protein -
  LMJ46_RS00515 (LMJ46_00515) - 93458..93877 (+) 420 WP_002411217.1 DUF6673 family protein -
  LMJ46_RS00520 (LMJ46_00520) - 93883..94455 (+) 573 WP_010784204.1 Gp15 family bacteriophage protein -
  LMJ46_RS00525 (LMJ46_00525) - 94448..97768 (+) 3321 WP_033787715.1 hypothetical protein -
  LMJ46_RS00530 (LMJ46_00530) - 97768..98529 (+) 762 WP_085368125.1 distal tail protein Dit -
  LMJ46_RS00535 (LMJ46_00535) - 98526..100793 (+) 2268 WP_229017989.1 phage tail spike protein -
  LMJ46_RS00540 (LMJ46_00540) - 100793..102274 (+) 1482 WP_229017990.1 BppU family phage baseplate upper protein -
  LMJ46_RS00545 (LMJ46_00545) - 102351..102605 (+) 255 WP_229017991.1 hemolysin XhlA family protein -
  LMJ46_RS00550 (LMJ46_00550) - 102608..102814 (+) 207 WP_229017992.1 phage holin -
  LMJ46_RS00555 (LMJ46_00555) - 102817..103902 (+) 1086 WP_010816176.1 SH3 domain-containing protein -
  LMJ46_RS00560 (LMJ46_00560) - 104296..104829 (+) 534 WP_002402066.1 PBECR4 domain-containing protein -

Sequence


Protein


Download         Length: 175 a.a.        Molecular weight: 19235.07 Da        Isoelectric Point: 4.7078

>NTDB_id=624816 LMJ46_RS00370 WP_010826244.1 75975..76502(+) (ssb) [Enterococcus faecalis strain R5]
MINNVVLVGRLTKDPDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLEAKSANENRNSIQSSQNSVTGVQNNFESNYAANQNKGLNQQNNSQQISFGGDVDPFA
GAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=624816 LMJ46_RS00370 WP_010826244.1 75975..76502(+) (ssb) [Enterococcus faecalis strain R5]
ATGATAAATAATGTGGTATTAGTCGGAAGATTGACAAAAGATCCTGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGTAAAGGAACATTATTAGGAGTTGTTGGCAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTGTTTGCGAGAGTTTCCAATTATTAGAGGCAAAAAG
CGCCAATGAGAATAGAAATAGCATTCAGAGTTCACAGAATAGCGTTACAGGCGTTCAAAATAATTTCGAGAGTAATTATG
CTGCGAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATATCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGTGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCGTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

58.989

100

0.6

  ssbA Bacillus subtilis subsp. subtilis str. 168

57.303

100

0.583

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

60.571

0.36