Detailed information
Overview
| Name | comGD | Type | Machinery gene |
| Locus tag | LL046_RS11355 | Genome accession | NZ_CP086088 |
| Coordinates | 2218620..2219051 (-) | Length | 143 a.a. |
| NCBI ID | WP_026138965.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. lactis strain EIP13A | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2215349..2256114 | 2218620..2219051 | within | 0 |
Gene organization within MGE regions
Location: 2215349..2256114
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LL046_RS11325 (LL046_11290) | - | 2215349..2216086 (-) | 738 | WP_240819121.1 | metal ABC transporter ATP-binding protein | - |
| LL046_RS11330 (LL046_11295) | - | 2216263..2217105 (-) | 843 | WP_017865154.1 | metal ABC transporter substrate-binding protein | - |
| LL046_RS11335 (LL046_11300) | - | 2217102..2217539 (-) | 438 | WP_010906313.1 | zinc-dependent MarR family transcriptional regulator | - |
| LL046_RS11340 (LL046_11305) | comGG | 2217620..2217904 (-) | 285 | WP_017865155.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LL046_RS11345 (LL046_11310) | comGF | 2217943..2218389 (-) | 447 | WP_032948129.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LL046_RS11350 (LL046_11315) | comGE | 2218352..2218648 (-) | 297 | WP_017865157.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LL046_RS11355 (LL046_11320) | comGD | 2218620..2219051 (-) | 432 | WP_026138965.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LL046_RS11360 (LL046_11325) | comGC | 2219011..2219280 (-) | 270 | WP_023349160.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LL046_RS11370 (LL046_11335) | - | 2219863..2220642 (-) | 780 | WP_240819119.1 | peptidoglycan amidohydrolase family protein | - |
| LL046_RS11375 (LL046_11340) | - | 2220642..2220917 (-) | 276 | WP_240819117.1 | holin | - |
| LL046_RS11380 (LL046_11345) | - | 2220901..2221230 (-) | 330 | WP_240819115.1 | hypothetical protein | - |
| LL046_RS11385 (LL046_11350) | - | 2221243..2221479 (-) | 237 | WP_394535571.1 | hypothetical protein | - |
| LL046_RS11390 (LL046_11355) | - | 2221488..2223140 (-) | 1653 | WP_394535572.1 | hypothetical protein | - |
| LL046_RS11395 (LL046_11360) | - | 2223118..2223291 (-) | 174 | WP_240819270.1 | hypothetical protein | - |
| LL046_RS11400 (LL046_11365) | - | 2223291..2224412 (-) | 1122 | WP_240819268.1 | hypothetical protein | - |
| LL046_RS11405 (LL046_11370) | - | 2224428..2226239 (-) | 1812 | WP_240819266.1 | phage tail protein | - |
| LL046_RS11410 (LL046_11375) | - | 2226218..2227744 (-) | 1527 | WP_240819263.1 | distal tail protein Dit | - |
| LL046_RS11415 (LL046_11380) | - | 2227754..2230363 (-) | 2610 | WP_240819261.1 | phage tail tape measure protein | - |
| LL046_RS11420 (LL046_11385) | - | 2230353..2231060 (-) | 708 | WP_003131324.1 | Gp15 family bacteriophage protein | - |
| LL046_RS11425 (LL046_11390) | - | 2231076..2231483 (-) | 408 | WP_003131323.1 | hypothetical protein | - |
| LL046_RS11430 (LL046_11395) | - | 2231540..2232016 (-) | 477 | WP_014570559.1 | phage tail tube protein | - |
| LL046_RS11435 (LL046_11400) | - | 2232027..2232461 (-) | 435 | WP_003131321.1 | minor capsid protein | - |
| LL046_RS11440 (LL046_11405) | - | 2232461..2232790 (-) | 330 | WP_003131320.1 | hypothetical protein | - |
| LL046_RS11445 (LL046_11410) | - | 2232787..2233131 (-) | 345 | WP_014570557.1 | putative minor capsid protein | - |
| LL046_RS11450 (LL046_11415) | - | 2233121..2233522 (-) | 402 | WP_240819259.1 | hypothetical protein | - |
| LL046_RS11455 (LL046_11420) | - | 2233596..2233832 (-) | 237 | WP_014570555.1 | Ig-like domain-containing protein | - |
| LL046_RS11460 (LL046_11425) | - | 2233861..2234778 (-) | 918 | WP_003131315.1 | hypothetical protein | - |
| LL046_RS11465 (LL046_11430) | - | 2234793..2235845 (-) | 1053 | WP_137016559.1 | XkdF-like putative serine protease domain-containing protein | - |
| LL046_RS11470 (LL046_11435) | - | 2235861..2236691 (-) | 831 | WP_014570553.1 | phage minor head protein | - |
| LL046_RS11475 (LL046_11440) | - | 2236684..2238213 (-) | 1530 | WP_014570552.1 | phage portal protein | - |
| LL046_RS11480 (LL046_11445) | terL | 2238226..2239677 (-) | 1452 | WP_240819257.1 | phage terminase large subunit | - |
| LL046_RS11485 (LL046_11450) | - | 2239658..2240467 (-) | 810 | WP_095345918.1 | HNH endonuclease | - |
| LL046_RS11490 (LL046_11455) | - | 2240639..2241028 (-) | 390 | WP_003131303.1 | DUF722 domain-containing protein | - |
| LL046_RS11495 (LL046_11460) | - | 2241111..2241425 (-) | 315 | WP_240819255.1 | hypothetical protein | - |
| LL046_RS11500 (LL046_11465) | - | 2241422..2241604 (-) | 183 | WP_240819253.1 | hypothetical protein | - |
| LL046_RS11505 (LL046_11470) | - | 2241650..2242003 (-) | 354 | WP_058224328.1 | hypothetical protein | - |
| LL046_RS11510 (LL046_11475) | - | 2242000..2242188 (-) | 189 | WP_240819251.1 | DUF1660 domain-containing protein | - |
| LL046_RS11515 (LL046_11480) | - | 2242185..2242415 (-) | 231 | WP_240819248.1 | hypothetical protein | - |
| LL046_RS11520 (LL046_11485) | - | 2242434..2242769 (-) | 336 | WP_240819246.1 | DUF1140 family protein | - |
| LL046_RS11525 (LL046_11490) | - | 2242766..2243152 (-) | 387 | WP_240819245.1 | hypothetical protein | - |
| LL046_RS11530 | - | 2243145..2243267 (-) | 123 | WP_259743407.1 | hypothetical protein | - |
| LL046_RS11535 (LL046_11495) | - | 2243260..2243457 (-) | 198 | WP_240819243.1 | hypothetical protein | - |
| LL046_RS11540 (LL046_11500) | - | 2243454..2243825 (-) | 372 | WP_240819241.1 | hypothetical protein | - |
| LL046_RS11545 (LL046_11505) | - | 2243822..2244451 (-) | 630 | WP_240819239.1 | DUF1642 domain-containing protein | - |
| LL046_RS11550 (LL046_11510) | - | 2244444..2244596 (-) | 153 | WP_015967991.1 | hypothetical protein | - |
| LL046_RS11555 (LL046_11515) | - | 2244589..2244948 (-) | 360 | WP_240819237.1 | hypothetical protein | - |
| LL046_RS11560 (LL046_11520) | - | 2244957..2245466 (-) | 510 | WP_240819236.1 | hypothetical protein | - |
| LL046_RS11565 (LL046_11525) | - | 2245481..2245813 (-) | 333 | WP_240819235.1 | hypothetical protein | - |
| LL046_RS11570 (LL046_11530) | - | 2245918..2246310 (-) | 393 | WP_240819234.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LL046_RS11575 (LL046_11535) | - | 2246346..2246588 (-) | 243 | WP_240819233.1 | hypothetical protein | - |
| LL046_RS11580 (LL046_11540) | - | 2246581..2247507 (-) | 927 | WP_240819232.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LL046_RS11585 (LL046_11545) | - | 2247772..2248698 (-) | 927 | WP_101961531.1 | RecT family recombinase | - |
| LL046_RS11590 (LL046_11550) | - | 2248695..2249528 (-) | 834 | WP_240819231.1 | hypothetical protein | - |
| LL046_RS11595 (LL046_11555) | - | 2249632..2249880 (-) | 249 | WP_029344340.1 | hypothetical protein | - |
| LL046_RS11600 | - | 2249893..2250015 (-) | 123 | WP_023164646.1 | hypothetical protein | - |
| LL046_RS11605 (LL046_11560) | - | 2250012..2250194 (-) | 183 | WP_003130605.1 | hypothetical protein | - |
| LL046_RS11610 (LL046_11565) | - | 2250210..2250911 (-) | 702 | WP_240819230.1 | Rha family transcriptional regulator | - |
| LL046_RS11615 (LL046_11570) | - | 2250971..2251204 (+) | 234 | WP_168784908.1 | hypothetical protein | - |
| LL046_RS11620 | - | 2251201..2251326 (-) | 126 | WP_259743439.1 | hypothetical protein | - |
| LL046_RS11625 (LL046_11575) | - | 2251372..2251593 (-) | 222 | WP_172758712.1 | helix-turn-helix transcriptional regulator | - |
| LL046_RS11630 (LL046_11580) | - | 2251749..2252171 (+) | 423 | WP_240819228.1 | helix-turn-helix transcriptional regulator | - |
| LL046_RS11635 (LL046_11585) | - | 2252182..2252766 (+) | 585 | WP_014570821.1 | hypothetical protein | - |
| LL046_RS11640 (LL046_11590) | - | 2252822..2253361 (+) | 540 | WP_023189015.1 | PH domain-containing protein | - |
| LL046_RS11645 (LL046_11595) | - | 2253487..2254944 (+) | 1458 | WP_240819271.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 143 a.a. Molecular weight: 16502.58 Da Isoelectric Point: 9.8949
>NTDB_id=622451 LL046_RS11355 WP_026138965.1 2218620..2219051(-) (comGD) [Lactococcus lactis subsp. lactis strain EIP13A]
MIRIKMKNEILMTRAFTLLESLLVLLIISFITTLFSLEIIQTVHLFKGELFVLQFENFYKRSQEAAALLQKSESLVAKNQ
ELICEDRSITIPKEVAVKDFTVKFDDKGGNSSLQKLTIFLPYEKKFITYQLEIGSGKFKKKIS
MIRIKMKNEILMTRAFTLLESLLVLLIISFITTLFSLEIIQTVHLFKGELFVLQFENFYKRSQEAAALLQKSESLVAKNQ
ELICEDRSITIPKEVAVKDFTVKFDDKGGNSSLQKLTIFLPYEKKFITYQLEIGSGKFKKKIS
Nucleotide
Download Length: 432 bp
>NTDB_id=622451 LL046_RS11355 WP_026138965.1 2218620..2219051(-) (comGD) [Lactococcus lactis subsp. lactis strain EIP13A]
ATGATCAGAATAAAAATGAAGAACGAAATTTTAATGACTAGAGCATTTACTTTACTAGAGTCTCTTCTAGTTTTGTTGAT
TATTTCTTTTATCACAACTCTTTTTTCTTTAGAAATAATACAAACAGTCCATCTTTTTAAGGGAGAACTGTTTGTTCTCC
AGTTTGAAAATTTCTATAAAAGGAGTCAAGAAGCTGCTGCACTGCTTCAAAAATCTGAAAGTTTAGTTGCTAAAAATCAA
GAATTAATCTGTGAAGATAGAAGTATCACAATTCCAAAGGAGGTAGCAGTTAAAGATTTTACAGTTAAATTTGATGATAA
GGGAGGGAATTCTAGCTTACAAAAACTCACAATTTTTTTACCTTACGAAAAAAAGTTCATCACTTATCAATTGGAGATAG
GCAGTGGAAAATTTAAAAAGAAAATCAGTTAA
ATGATCAGAATAAAAATGAAGAACGAAATTTTAATGACTAGAGCATTTACTTTACTAGAGTCTCTTCTAGTTTTGTTGAT
TATTTCTTTTATCACAACTCTTTTTTCTTTAGAAATAATACAAACAGTCCATCTTTTTAAGGGAGAACTGTTTGTTCTCC
AGTTTGAAAATTTCTATAAAAGGAGTCAAGAAGCTGCTGCACTGCTTCAAAAATCTGAAAGTTTAGTTGCTAAAAATCAA
GAATTAATCTGTGAAGATAGAAGTATCACAATTCCAAAGGAGGTAGCAGTTAAAGATTTTACAGTTAAATTTGATGATAA
GGGAGGGAATTCTAGCTTACAAAAACTCACAATTTTTTTACCTTACGAAAAAAAGTTCATCACTTATCAATTGGAGATAG
GCAGTGGAAAATTTAAAAAGAAAATCAGTTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD | Lactococcus lactis subsp. cremoris KW2 |
67.133 |
100 |
0.671 |
| comYD | Streptococcus gordonii str. Challis substr. CH1 |
39.007 |
98.601 |
0.385 |
| comYD | Streptococcus mutans UA140 |
40.625 |
89.51 |
0.364 |
| comYD | Streptococcus mutans UA159 |
40.625 |
89.51 |
0.364 |