Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   LK454_RS06585 Genome accession   NZ_CP085923
Coordinates   1353050..1353163 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain FDAARGOS_1601     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1348050..1358163
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LK454_RS06560 (LK454_06560) - 1348107..1350332 (+) 2226 WP_001051484.1 ATP-dependent Clp protease ATP-binding subunit -
  LK454_RS06565 (LK454_06565) panD 1350322..1350672 (+) 351 WP_000142228.1 aspartate 1-decarboxylase -
  LK454_RS06570 (LK454_06570) - 1350683..1350976 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  LK454_RS06575 (LK454_06575) - 1350976..1351971 (+) 996 WP_000468494.1 PDZ domain-containing protein -
  LK454_RS06580 (LK454_06580) comB6 1351979..1353034 (+) 1056 WP_000786653.1 P-type conjugative transfer protein TrbL Machinery gene
  LK454_RS06585 (LK454_06585) comB7 1353050..1353163 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  LK454_RS06590 (LK454_06590) comB8 1353160..1353897 (+) 738 WP_001208410.1 virB8 family protein Machinery gene
  LK454_RS06595 (LK454_06595) comB9 1353897..1354892 (+) 996 WP_001864273.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  LK454_RS06600 (LK454_06600) comB10 1354885..1356015 (+) 1131 WP_001045886.1 DNA type IV secretion system protein ComB10 Machinery gene
  LK454_RS06605 (LK454_06605) - 1356085..1357512 (+) 1428 WP_000694864.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=621295 LK454_RS06585 WP_001217873.1 1353050..1353163(+) (comB7) [Helicobacter pylori strain FDAARGOS_1601]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=621295 LK454_RS06585 WP_001217873.1 1353050..1353163(+) (comB7) [Helicobacter pylori strain FDAARGOS_1601]
ATGAGGATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1