Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   LIT36_RS11895 Genome accession   NZ_CP085706
Coordinates   2459276..2459653 (-) Length   125 a.a.
NCBI ID   WP_015388005.1    Uniprot ID   -
Organism   Bacillus velezensis strain CK17     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2454276..2464653
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LIT36_RS11855 (LIT36_11865) - 2454774..2455568 (+) 795 WP_014305407.1 YqhG family protein -
  LIT36_RS11860 (LIT36_11870) sinI 2455745..2455918 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LIT36_RS11865 (LIT36_11875) sinR 2455952..2456287 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LIT36_RS11870 (LIT36_11880) tasA 2456335..2457120 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  LIT36_RS11875 (LIT36_11885) sipW 2457184..2457768 (-) 585 WP_012117977.1 signal peptidase I SipW -
  LIT36_RS11880 (LIT36_11890) tapA 2457740..2458411 (-) 672 WP_015388007.1 amyloid fiber anchoring/assembly protein TapA -
  LIT36_RS11885 (LIT36_11895) - 2458671..2459000 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  LIT36_RS11890 (LIT36_11900) - 2459040..2459219 (-) 180 WP_003153093.1 YqzE family protein -
  LIT36_RS11895 (LIT36_11905) comGG 2459276..2459653 (-) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  LIT36_RS11900 (LIT36_11910) comGF 2459654..2460049 (-) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF -
  LIT36_RS11905 (LIT36_11915) comGE 2460063..2460377 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  LIT36_RS11910 (LIT36_11920) comGD 2460361..2460798 (-) 438 WP_015388002.1 competence type IV pilus minor pilin ComGD Machinery gene
  LIT36_RS11915 (LIT36_11925) comGC 2460788..2461096 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  LIT36_RS11920 (LIT36_11930) comGB 2461101..2462138 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  LIT36_RS11925 (LIT36_11935) comGA 2462125..2463195 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  LIT36_RS11930 (LIT36_11940) - 2463387..2464337 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14182.19 Da        Isoelectric Point: 9.9592

>NTDB_id=619427 LIT36_RS11895 WP_015388005.1 2459276..2459653(-) (comGG) [Bacillus velezensis strain CK17]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGIQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=619427 LIT36_RS11895 WP_015388005.1 2459276..2459653(-) (comGG) [Bacillus velezensis strain CK17]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTATACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504