Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LIT36_RS11860 Genome accession   NZ_CP085706
Coordinates   2455745..2455918 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain CK17     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2450745..2460918
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LIT36_RS11845 (LIT36_11855) gcvT 2451563..2452663 (-) 1101 WP_015388009.1 glycine cleavage system aminomethyltransferase GcvT -
  LIT36_RS11850 (LIT36_11860) - 2453086..2454756 (+) 1671 WP_003153107.1 SNF2-related protein -
  LIT36_RS11855 (LIT36_11865) - 2454774..2455568 (+) 795 WP_014305407.1 YqhG family protein -
  LIT36_RS11860 (LIT36_11870) sinI 2455745..2455918 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LIT36_RS11865 (LIT36_11875) sinR 2455952..2456287 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LIT36_RS11870 (LIT36_11880) tasA 2456335..2457120 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  LIT36_RS11875 (LIT36_11885) sipW 2457184..2457768 (-) 585 WP_012117977.1 signal peptidase I SipW -
  LIT36_RS11880 (LIT36_11890) tapA 2457740..2458411 (-) 672 WP_015388007.1 amyloid fiber anchoring/assembly protein TapA -
  LIT36_RS11885 (LIT36_11895) - 2458671..2459000 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  LIT36_RS11890 (LIT36_11900) - 2459040..2459219 (-) 180 WP_003153093.1 YqzE family protein -
  LIT36_RS11895 (LIT36_11905) comGG 2459276..2459653 (-) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  LIT36_RS11900 (LIT36_11910) comGF 2459654..2460049 (-) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF -
  LIT36_RS11905 (LIT36_11915) comGE 2460063..2460377 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  LIT36_RS11910 (LIT36_11920) comGD 2460361..2460798 (-) 438 WP_015388002.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=619425 LIT36_RS11860 WP_003153105.1 2455745..2455918(+) (sinI) [Bacillus velezensis strain CK17]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=619425 LIT36_RS11860 WP_003153105.1 2455745..2455918(+) (sinI) [Bacillus velezensis strain CK17]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702