Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   LJA38_RS11835 Genome accession   NZ_CP085283
Coordinates   2484250..2484564 (-) Length   104 a.a.
NCBI ID   WP_041481885.1    Uniprot ID   -
Organism   Bacillus velezensis strain TPS3N     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2479250..2489564
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LJA38_RS11790 sinI 2479933..2480106 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LJA38_RS11795 sinR 2480140..2480475 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LJA38_RS11800 tasA 2480523..2481308 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  LJA38_RS11805 sipW 2481372..2481956 (-) 585 WP_012117977.1 signal peptidase I SipW -
  LJA38_RS11810 tapA 2481928..2482599 (-) 672 WP_063174755.1 amyloid fiber anchoring/assembly protein TapA -
  LJA38_RS11815 - 2482858..2483187 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  LJA38_RS11820 - 2483227..2483406 (-) 180 WP_003153093.1 YqzE family protein -
  LJA38_RS11825 comGG 2483463..2483840 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  LJA38_RS11830 comGF 2483841..2484341 (-) 501 WP_232789965.1 competence type IV pilus minor pilin ComGF -
  LJA38_RS11835 comGE 2484250..2484564 (-) 315 WP_041481885.1 competence type IV pilus minor pilin ComGE Machinery gene
  LJA38_RS11840 comGD 2484548..2484985 (-) 438 WP_095318402.1 competence type IV pilus minor pilin ComGD Machinery gene
  LJA38_RS11845 comGC 2484975..2485283 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  LJA38_RS11850 comGB 2485288..2486325 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  LJA38_RS11855 comGA 2486312..2487382 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  LJA38_RS11860 - 2487574..2488524 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11830.82 Da        Isoelectric Point: 6.9470

>NTDB_id=616977 LJA38_RS11835 WP_041481885.1 2484250..2484564(-) (comGE) [Bacillus velezensis strain TPS3N]
MLNGNKGFSTIETLSAMAVWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=616977 LJA38_RS11835 WP_041481885.1 2484250..2484564(-) (comGE) [Bacillus velezensis strain TPS3N]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCGTTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481