Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   LJA38_RS11790 Genome accession   NZ_CP085283
Coordinates   2479933..2480106 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain TPS3N     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2474933..2485106
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LJA38_RS11775 gcvT 2475751..2476851 (-) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -
  LJA38_RS11780 - 2477274..2478944 (+) 1671 WP_003153107.1 SNF2-related protein -
  LJA38_RS11785 - 2478962..2479756 (+) 795 WP_014305407.1 YqhG family protein -
  LJA38_RS11790 sinI 2479933..2480106 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LJA38_RS11795 sinR 2480140..2480475 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LJA38_RS11800 tasA 2480523..2481308 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  LJA38_RS11805 sipW 2481372..2481956 (-) 585 WP_012117977.1 signal peptidase I SipW -
  LJA38_RS11810 tapA 2481928..2482599 (-) 672 WP_063174755.1 amyloid fiber anchoring/assembly protein TapA -
  LJA38_RS11815 - 2482858..2483187 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  LJA38_RS11820 - 2483227..2483406 (-) 180 WP_003153093.1 YqzE family protein -
  LJA38_RS11825 comGG 2483463..2483840 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  LJA38_RS11830 comGF 2483841..2484341 (-) 501 WP_232789965.1 competence type IV pilus minor pilin ComGF -
  LJA38_RS11835 comGE 2484250..2484564 (-) 315 WP_041481885.1 competence type IV pilus minor pilin ComGE Machinery gene
  LJA38_RS11840 comGD 2484548..2484985 (-) 438 WP_095318402.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=616974 LJA38_RS11790 WP_003153105.1 2479933..2480106(+) (sinI) [Bacillus velezensis strain TPS3N]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=616974 LJA38_RS11790 WP_003153105.1 2479933..2480106(+) (sinI) [Bacillus velezensis strain TPS3N]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702