Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   LJA36_RS14125 Genome accession   NZ_CP085282
Coordinates   2970563..2970703 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain TPS17     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2965563..2975703
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LJA36_RS14100 - 2965869..2966267 (+) 399 WP_003152031.1 DUF1694 domain-containing protein -
  LJA36_RS14105 - 2966364..2966915 (+) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  LJA36_RS14110 - 2966933..2968399 (+) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  LJA36_RS14115 - 2968529..2969752 (+) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  LJA36_RS14120 - 2969759..2970100 (-) 342 WP_015418107.1 hypothetical protein -
  LJA36_RS14125 degQ 2970563..2970703 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  LJA36_RS14130 comQ 2970834..2971820 (+) 987 WP_269195024.1 class 1 isoprenoid biosynthesis enzyme Regulator
  LJA36_RS14135 comX 2971783..2971953 (+) 171 WP_003152048.1 competence pheromone ComX Regulator
  LJA36_RS14140 comP 2971973..2974276 (+) 2304 WP_040238945.1 histidine kinase Regulator
  LJA36_RS14145 comA 2974357..2975001 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  LJA36_RS14150 - 2975023..2975406 (+) 384 WP_040238946.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=616909 LJA36_RS14125 WP_003152043.1 2970563..2970703(+) (degQ) [Bacillus amyloliquefaciens strain TPS17]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=616909 LJA36_RS14125 WP_003152043.1 2970563..2970703(+) (degQ) [Bacillus amyloliquefaciens strain TPS17]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891