Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   LG951_RS15550 Genome accession   NZ_CP085037
Coordinates   2971130..2971270 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain BIM B-171     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2966130..2976270
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LG951_RS15525 (LG951_15525) - 2966465..2966854 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  LG951_RS15530 (LG951_15530) comA 2966878..2967519 (-) 642 WP_003213500.1 response regulator transcription factor Regulator
  LG951_RS15535 (LG951_15535) comP 2967600..2969891 (-) 2292 WP_106036183.1 ATP-binding protein Regulator
  LG951_RS15540 (LG951_15540) comX 2969898..2970077 (-) 180 WP_034620107.1 competence pheromone ComX -
  LG951_RS15545 (LG951_15545) - 2970055..2970978 (-) 924 WP_003212977.1 polyprenyl synthetase family protein -
  LG951_RS15550 (LG951_15550) degQ 2971130..2971270 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  LG951_RS15555 (LG951_15555) - 2971776..2972129 (+) 354 WP_034620108.1 hypothetical protein -
  LG951_RS15560 (LG951_15560) - 2972160..2973386 (-) 1227 WP_106032245.1 EAL and HDOD domain-containing protein -
  LG951_RS15565 (LG951_15565) - 2973526..2974995 (-) 1470 WP_003212630.1 nicotinate phosphoribosyltransferase -
  LG951_RS15570 (LG951_15570) - 2975013..2975564 (-) 552 WP_003213138.1 cysteine hydrolase family protein -
  LG951_RS15575 (LG951_15575) - 2975625..2976032 (-) 408 WP_050944045.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=614837 LG951_RS15550 WP_003213123.1 2971130..2971270(-) (degQ) [Bacillus pumilus strain BIM B-171]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=614837 LG951_RS15550 WP_003213123.1 2971130..2971270(-) (degQ) [Bacillus pumilus strain BIM B-171]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696