Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   EL334_RS00225 Genome accession   NZ_AP019192
Coordinates   39419..39577 (+) Length   52 a.a.
NCBI ID   WP_001093073.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain ASP0581     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 34419..44577
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL334_RS00200 (ASP0581_00310) - 35716..36885 (+) 1170 WP_023396089.1 pyridoxal phosphate-dependent aminotransferase -
  EL334_RS00205 (ASP0581_00320) recO 36882..37652 (+) 771 WP_023396090.1 DNA repair protein RecO Machinery gene
  EL334_RS00210 (ASP0581_00330) plsX 37649..38641 (+) 993 WP_023396091.1 phosphate acyltransferase PlsX -
  EL334_RS00215 (ASP0581_00340) - 38647..38880 (+) 234 WP_000136446.1 acyl carrier protein -
  EL334_RS00220 (ASP0581_00350) - 38917..39216 (+) 300 Protein_34 transposase family protein -
  EL334_RS00225 (ASP0581_00360) cipB 39419..39577 (+) 159 WP_001093073.1 bacteriocin class II family protein Regulator
  EL334_RS12455 - 39580..39705 (+) 126 WP_000346297.1 PncF family bacteriocin immunity protein -
  EL334_RS00230 (ASP0581_00370) comA 40296..42449 (+) 2154 WP_000668280.1 peptide cleavage/export ABC transporter ComA Regulator
  EL334_RS00235 (ASP0581_00380) comB 42462..43811 (+) 1350 WP_000801620.1 competence pheromone export protein ComB Regulator

Sequence


Protein


Download         Length: 52 a.a.        Molecular weight: 5435.25 Da        Isoelectric Point: 4.2644

>NTDB_id=61381 EL334_RS00225 WP_001093073.1 39419..39577(+) (cipB) [Streptococcus pneumoniae strain ASP0581]
MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAILGGVAYAATCWW

Nucleotide


Download         Length: 159 bp        

>NTDB_id=61381 EL334_RS00225 WP_001093073.1 39419..39577(+) (cipB) [Streptococcus pneumoniae strain ASP0581]
ATGAATACAAAAAAGATGTCACAATTTGAAATTATGGATACTGAGATGCTTGCTTGCGTTGAAGGTGGCGGATGCAATTG
GGGAGATTTTGCCAAAGCAGGTGTTGGAGGAGGAGCTATACTTGGAGGTGTGGCCTATGCAGCGACATGTTGGTGGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

44

96.154

0.423


Multiple sequence alignment