Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   NPS18_RS08860 Genome accession   NZ_CP101984
Coordinates   1794722..1794952 (-) Length   76 a.a.
NCBI ID   WP_002265368.1    Uniprot ID   Q8DS95
Organism   Streptococcus mutans strain UA-159     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 1789722..1799952
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NPS18_RS08825 (NPS18_08825) - 1789931..1790119 (-) 189 WP_002263743.1 Blp family class II bacteriocin -
  NPS18_RS08830 (NPS18_08830) - 1790283..1790495 (-) 213 WP_002263744.1 Blp family class II bacteriocin -
  NPS18_RS08835 (NPS18_08835) - 1790900..1791064 (-) 165 WP_002265308.1 hypothetical protein -
  NPS18_RS08840 (NPS18_08840) - 1791504..1791716 (+) 213 Protein_1696 IS3 family transposase -
  NPS18_RS08845 (NPS18_08845) - 1791839..1792243 (-) 405 WP_002263912.1 hypothetical protein -
  NPS18_RS08850 (NPS18_08850) - 1792390..1792809 (-) 420 WP_002263913.1 hypothetical protein -
  NPS18_RS08855 (NPS18_08855) - 1794190..1794591 (-) 402 WP_002310604.1 hypothetical protein -
  NPS18_RS08860 (NPS18_08860) cipB 1794722..1794952 (-) 231 WP_002265368.1 Blp family class II bacteriocin Regulator
  NPS18_RS08865 (NPS18_08865) comC/blpC 1795219..1795359 (+) 141 WP_002267610.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  NPS18_RS08870 (NPS18_08870) comD/blpH 1795501..1796826 (-) 1326 WP_002262113.1 sensor histidine kinase Regulator
  NPS18_RS08875 (NPS18_08875) comE/blpR 1796823..1797575 (-) 753 WP_002262114.1 response regulator transcription factor Regulator
  NPS18_RS08880 (NPS18_08880) - 1798047..1798685 (-) 639 WP_002262115.1 VTT domain-containing protein -
  NPS18_RS08885 (NPS18_08885) - 1798732..1799358 (-) 627 WP_002262116.1 hypothetical protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 7262.08 Da        Isoelectric Point: 3.7781

>NTDB_id=613656 NPS18_RS08860 WP_002265368.1 1794722..1794952(-) (cipB) [Streptococcus mutans strain UA-159]
MNTQAFEQFNVMDNEALSAVEGGGRGWNCAAGIALGAGQGYMATAGGTAFLGPYAIGTGAFGAIAGGIGGALNSCG

Nucleotide


Download         Length: 231 bp        

>NTDB_id=613656 NPS18_RS08860 WP_002265368.1 1794722..1794952(-) (cipB) [Streptococcus mutans strain UA-159]
ATGAATACACAAGCATTTGAACAATTTAACGTAATGGATAATGAAGCACTTTCAGCTGTTGAAGGTGGGGGCCGCGGATG
GAATTGTGCAGCAGGTATTGCTCTAGGTGCTGGGCAAGGTTATATGGCTACTGCAGGCGGTACAGCATTTCTTGGTCCAT
ATGCTATTGGCACTGGTGCCTTTGGGGCTATTGCTGGAGGAATCGGAGGAGCTCTTAATTCCTGTGGTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8DS95

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

100

100

1