Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BASU_RS14640 Genome accession   NC_022081
Coordinates   2991893..2992033 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis UCMB5113     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2986893..2997033
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BASU_RS14615 (BASU_2796) - 2987207..2987590 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  BASU_RS14620 (BASU_2797) comA 2987612..2988256 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  BASU_RS14625 (BASU_2798) comP 2988337..2990688 (-) 2352 WP_020956269.1 histidine kinase Regulator
  BASU_RS14630 (BASU_2799) comX 2990666..2990836 (-) 171 WP_015418105.1 competence pheromone ComX -
  BASU_RS14635 (BASU_2800) - 2990833..2991762 (-) 930 WP_231945405.1 polyprenyl synthetase family protein -
  BASU_RS14640 (BASU_2801) degQ 2991893..2992033 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BASU_RS14645 (BASU_2802) - 2992498..2992839 (+) 342 WP_007408677.1 hypothetical protein -
  BASU_RS14650 (BASU_2803) - 2992846..2994069 (-) 1224 WP_020956271.1 EAL and HDOD domain-containing protein -
  BASU_RS14655 (BASU_2804) - 2994199..2995665 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  BASU_RS14660 (BASU_2805) - 2995683..2996234 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  BASU_RS14665 (BASU_2806) - 2996331..2996729 (-) 399 WP_020956272.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=61136 BASU_RS14640 WP_003152043.1 2991893..2992033(-) (degQ) [Bacillus velezensis UCMB5113]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=61136 BASU_RS14640 WP_003152043.1 2991893..2992033(-) (degQ) [Bacillus velezensis UCMB5113]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment