Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   RBAU_RS12400 Genome accession   NC_022075
Coordinates   2590012..2590449 (-) Length   145 a.a.
NCBI ID   WP_007408322.1    Uniprot ID   -
Organism   Bacillus velezensis UCMB5033     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2585012..2595449
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RBAU_RS12350 (RBAU_2428) sinI 2585396..2585569 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  RBAU_RS12355 (RBAU_2429) sinR 2585603..2585938 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RBAU_RS12360 (RBAU_2430) - 2585986..2586771 (-) 786 WP_007408329.1 TasA family protein -
  RBAU_RS12365 (RBAU_2431) - 2586836..2587420 (-) 585 WP_007408328.1 signal peptidase I -
  RBAU_RS12370 (RBAU_2432) tapA 2587392..2588063 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  RBAU_RS12375 (RBAU_2433) - 2588322..2588651 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  RBAU_RS12380 (RBAU_2434) - 2588691..2588870 (-) 180 WP_003153093.1 YqzE family protein -
  RBAU_RS12385 (RBAU_2435) comGG 2588927..2589304 (-) 378 WP_007408325.1 competence type IV pilus minor pilin ComGG Machinery gene
  RBAU_RS12390 (RBAU_2436) comGF 2589305..2589805 (-) 501 WP_258566475.1 competence type IV pilus minor pilin ComGF -
  RBAU_RS12395 (RBAU_2437) comGE 2589714..2590028 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  RBAU_RS12400 (RBAU_2438) comGD 2590012..2590449 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene
  RBAU_RS12405 (RBAU_2439) comGC 2590439..2590705 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  RBAU_RS12410 (RBAU_2440) comGB 2590752..2591789 (-) 1038 WP_007408321.1 competence type IV pilus assembly protein ComGB Machinery gene
  RBAU_RS12415 (RBAU_2441) comGA 2591776..2592846 (-) 1071 WP_007408320.1 competence type IV pilus ATPase ComGA Machinery gene
  RBAU_RS12420 (RBAU_2442) - 2593038..2593988 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  RBAU_RS12425 (RBAU_2443) - 2594134..2595435 (+) 1302 WP_007408318.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16314.79 Da        Isoelectric Point: 10.2475

>NTDB_id=60990 RBAU_RS12400 WP_007408322.1 2590012..2590449(-) (comGD) [Bacillus velezensis UCMB5033]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=60990 RBAU_RS12400 WP_007408322.1 2590012..2590449(-) (comGD) [Bacillus velezensis UCMB5033]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAGATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566


Multiple sequence alignment