Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | RBAU_RS12350 | Genome accession | NC_022075 |
| Coordinates | 2585396..2585569 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis UCMB5033 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2580396..2590569
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RBAU_RS12335 (RBAU_2425) | gcvT | 2581209..2582309 (-) | 1101 | WP_007408332.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| RBAU_RS12340 (RBAU_2426) | - | 2582733..2584403 (+) | 1671 | WP_007408331.1 | SNF2-related protein | - |
| RBAU_RS12345 (RBAU_2427) | - | 2584425..2585219 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| RBAU_RS12350 (RBAU_2428) | sinI | 2585396..2585569 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| RBAU_RS12355 (RBAU_2429) | sinR | 2585603..2585938 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| RBAU_RS12360 (RBAU_2430) | - | 2585986..2586771 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| RBAU_RS12365 (RBAU_2431) | - | 2586836..2587420 (-) | 585 | WP_007408328.1 | signal peptidase I | - |
| RBAU_RS12370 (RBAU_2432) | tapA | 2587392..2588063 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| RBAU_RS12375 (RBAU_2433) | - | 2588322..2588651 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| RBAU_RS12380 (RBAU_2434) | - | 2588691..2588870 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| RBAU_RS12385 (RBAU_2435) | comGG | 2588927..2589304 (-) | 378 | WP_007408325.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| RBAU_RS12390 (RBAU_2436) | comGF | 2589305..2589805 (-) | 501 | WP_258566475.1 | competence type IV pilus minor pilin ComGF | - |
| RBAU_RS12395 (RBAU_2437) | comGE | 2589714..2590028 (-) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| RBAU_RS12400 (RBAU_2438) | comGD | 2590012..2590449 (-) | 438 | WP_007408322.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=60987 RBAU_RS12350 WP_003153105.1 2585396..2585569(+) (sinI) [Bacillus velezensis UCMB5033]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=60987 RBAU_RS12350 WP_003153105.1 2585396..2585569(+) (sinI) [Bacillus velezensis UCMB5033]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |