Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   LCH16_RS15465 Genome accession   NZ_CP083943
Coordinates   3156311..3156451 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain CSUSB3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3151311..3161451
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LCH16_RS15440 (LCH16_15440) - 3151625..3152008 (-) 384 WP_061860832.1 hotdog fold thioesterase -
  LCH16_RS15445 (LCH16_15445) comA 3152030..3152674 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  LCH16_RS15450 (LCH16_15450) comP 3152755..3155106 (-) 2352 WP_015418104.1 sensor histidine kinase Regulator
  LCH16_RS15455 (LCH16_15455) comX 3155084..3155254 (-) 171 WP_015418105.1 competence pheromone ComX -
  LCH16_RS15460 (LCH16_15460) - 3155251..3156180 (-) 930 WP_224462816.1 polyprenyl synthetase family protein -
  LCH16_RS15465 (LCH16_15465) degQ 3156311..3156451 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  LCH16_RS15470 (LCH16_15470) - 3156917..3157258 (+) 342 WP_015418107.1 hypothetical protein -
  LCH16_RS15475 (LCH16_15475) - 3157265..3158488 (-) 1224 WP_015418108.1 EAL and HDOD domain-containing protein -
  LCH16_RS15480 (LCH16_15480) - 3158618..3160084 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  LCH16_RS15485 (LCH16_15485) - 3160102..3160653 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  LCH16_RS15490 (LCH16_15490) - 3160750..3161148 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=608700 LCH16_RS15465 WP_003152043.1 3156311..3156451(-) (degQ) [Bacillus velezensis strain CSUSB3]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=608700 LCH16_RS15465 WP_003152043.1 3156311..3156451(-) (degQ) [Bacillus velezensis strain CSUSB3]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891