Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LCH16_RS12430 Genome accession   NZ_CP083943
Coordinates   2580816..2581193 (-) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain CSUSB3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2575816..2586193
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LCH16_RS12390 (LCH16_12390) - 2576315..2577109 (+) 795 WP_156240427.1 YqhG family protein -
  LCH16_RS12395 (LCH16_12395) sinI 2577286..2577459 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LCH16_RS12400 (LCH16_12400) sinR 2577493..2577828 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LCH16_RS12405 (LCH16_12405) tasA 2577876..2578661 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  LCH16_RS12410 (LCH16_12410) sipW 2578725..2579309 (-) 585 WP_012117977.1 signal peptidase I SipW -
  LCH16_RS12415 (LCH16_12415) tapA 2579281..2579952 (-) 672 WP_165625718.1 amyloid fiber anchoring/assembly protein TapA -
  LCH16_RS12420 (LCH16_12420) - 2580211..2580540 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  LCH16_RS12425 (LCH16_12425) - 2580580..2580759 (-) 180 WP_003153093.1 YqzE family protein -
  LCH16_RS12430 (LCH16_12430) comGG 2580816..2581193 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  LCH16_RS12435 (LCH16_12435) comGF 2581194..2581589 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  LCH16_RS12440 (LCH16_12440) comGE 2581603..2581917 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  LCH16_RS12445 (LCH16_12445) comGD 2581901..2582338 (-) 438 WP_224462754.1 competence type IV pilus minor pilin ComGD Machinery gene
  LCH16_RS12450 (LCH16_12450) comGC 2582328..2582636 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  LCH16_RS12455 (LCH16_12455) comGB 2582641..2583678 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  LCH16_RS12460 (LCH16_12460) comGA 2583665..2584735 (-) 1071 WP_213390994.1 competence type IV pilus ATPase ComGA Machinery gene
  LCH16_RS12465 (LCH16_12465) - 2584927..2585877 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=608680 LCH16_RS12430 WP_014305410.1 2580816..2581193(-) (comGG) [Bacillus velezensis strain CSUSB3]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=608680 LCH16_RS12430 WP_014305410.1 2580816..2581193(-) (comGG) [Bacillus velezensis strain CSUSB3]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512