Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LCH16_RS12395 Genome accession   NZ_CP083943
Coordinates   2577286..2577459 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain CSUSB3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2572286..2582459
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LCH16_RS12380 (LCH16_12380) gcvT 2573099..2574199 (-) 1101 WP_031378949.1 glycine cleavage system aminomethyltransferase GcvT -
  LCH16_RS12385 (LCH16_12385) - 2574623..2576293 (+) 1671 WP_015417810.1 DEAD/DEAH box helicase -
  LCH16_RS12390 (LCH16_12390) - 2576315..2577109 (+) 795 WP_156240427.1 YqhG family protein -
  LCH16_RS12395 (LCH16_12395) sinI 2577286..2577459 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LCH16_RS12400 (LCH16_12400) sinR 2577493..2577828 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LCH16_RS12405 (LCH16_12405) tasA 2577876..2578661 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  LCH16_RS12410 (LCH16_12410) sipW 2578725..2579309 (-) 585 WP_012117977.1 signal peptidase I SipW -
  LCH16_RS12415 (LCH16_12415) tapA 2579281..2579952 (-) 672 WP_165625718.1 amyloid fiber anchoring/assembly protein TapA -
  LCH16_RS12420 (LCH16_12420) - 2580211..2580540 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  LCH16_RS12425 (LCH16_12425) - 2580580..2580759 (-) 180 WP_003153093.1 YqzE family protein -
  LCH16_RS12430 (LCH16_12430) comGG 2580816..2581193 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  LCH16_RS12435 (LCH16_12435) comGF 2581194..2581589 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  LCH16_RS12440 (LCH16_12440) comGE 2581603..2581917 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  LCH16_RS12445 (LCH16_12445) comGD 2581901..2582338 (-) 438 WP_224462754.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=608678 LCH16_RS12395 WP_003153105.1 2577286..2577459(+) (sinI) [Bacillus velezensis strain CSUSB3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=608678 LCH16_RS12395 WP_003153105.1 2577286..2577459(+) (sinI) [Bacillus velezensis strain CSUSB3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702