Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LAZ96_RS02390 Genome accession   NZ_CP083715
Coordinates   462534..462707 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain DMB05     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 457534..467707
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LAZ96_RS02375 (LAZ96_02375) gcvT 458347..459447 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  LAZ96_RS02380 (LAZ96_02380) - 459871..461541 (+) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  LAZ96_RS02385 (LAZ96_02385) - 461563..462357 (+) 795 WP_014418368.1 YqhG family protein -
  LAZ96_RS02390 (LAZ96_02390) sinI 462534..462707 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  LAZ96_RS02395 (LAZ96_02395) sinR 462741..463076 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LAZ96_RS02400 (LAZ96_02400) tasA 463124..463909 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  LAZ96_RS02405 (LAZ96_02405) sipW 463974..464558 (-) 585 WP_014418370.1 signal peptidase I SipW -
  LAZ96_RS02410 (LAZ96_02410) tapA 464530..465201 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  LAZ96_RS02415 (LAZ96_02415) - 465460..465789 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  LAZ96_RS02420 (LAZ96_02420) - 465830..466009 (-) 180 WP_003153093.1 YqzE family protein -
  LAZ96_RS02425 (LAZ96_02425) comGG 466066..466443 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  LAZ96_RS02430 (LAZ96_02430) comGF 466444..466839 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  LAZ96_RS02435 (LAZ96_02435) comGE 466853..467167 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  LAZ96_RS02440 (LAZ96_02440) comGD 467151..467588 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=607377 LAZ96_RS02390 WP_014418369.1 462534..462707(+) (sinI) [Bacillus velezensis strain DMB05]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=607377 LAZ96_RS02390 WP_014418369.1 462534..462707(+) (sinI) [Bacillus velezensis strain DMB05]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719