Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | LAZ96_RS02390 | Genome accession | NZ_CP083715 |
| Coordinates | 462534..462707 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain DMB05 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 457534..467707
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LAZ96_RS02375 (LAZ96_02375) | gcvT | 458347..459447 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| LAZ96_RS02380 (LAZ96_02380) | - | 459871..461541 (+) | 1671 | WP_021494309.1 | DEAD/DEAH box helicase | - |
| LAZ96_RS02385 (LAZ96_02385) | - | 461563..462357 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| LAZ96_RS02390 (LAZ96_02390) | sinI | 462534..462707 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| LAZ96_RS02395 (LAZ96_02395) | sinR | 462741..463076 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| LAZ96_RS02400 (LAZ96_02400) | tasA | 463124..463909 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| LAZ96_RS02405 (LAZ96_02405) | sipW | 463974..464558 (-) | 585 | WP_014418370.1 | signal peptidase I SipW | - |
| LAZ96_RS02410 (LAZ96_02410) | tapA | 464530..465201 (-) | 672 | WP_025649852.1 | amyloid fiber anchoring/assembly protein TapA | - |
| LAZ96_RS02415 (LAZ96_02415) | - | 465460..465789 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| LAZ96_RS02420 (LAZ96_02420) | - | 465830..466009 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| LAZ96_RS02425 (LAZ96_02425) | comGG | 466066..466443 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LAZ96_RS02430 (LAZ96_02430) | comGF | 466444..466839 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| LAZ96_RS02435 (LAZ96_02435) | comGE | 466853..467167 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LAZ96_RS02440 (LAZ96_02440) | comGD | 467151..467588 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=607377 LAZ96_RS02390 WP_014418369.1 462534..462707(+) (sinI) [Bacillus velezensis strain DMB05]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=607377 LAZ96_RS02390 WP_014418369.1 462534..462707(+) (sinI) [Bacillus velezensis strain DMB05]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |