Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   LAZ96_RS02435 Genome accession   NZ_CP083715
Coordinates   466853..467167 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain DMB05     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 461853..472167
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LAZ96_RS02390 (LAZ96_02390) sinI 462534..462707 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  LAZ96_RS02395 (LAZ96_02395) sinR 462741..463076 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LAZ96_RS02400 (LAZ96_02400) tasA 463124..463909 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  LAZ96_RS02405 (LAZ96_02405) sipW 463974..464558 (-) 585 WP_014418370.1 signal peptidase I SipW -
  LAZ96_RS02410 (LAZ96_02410) tapA 464530..465201 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  LAZ96_RS02415 (LAZ96_02415) - 465460..465789 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  LAZ96_RS02420 (LAZ96_02420) - 465830..466009 (-) 180 WP_003153093.1 YqzE family protein -
  LAZ96_RS02425 (LAZ96_02425) comGG 466066..466443 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  LAZ96_RS02430 (LAZ96_02430) comGF 466444..466839 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  LAZ96_RS02435 (LAZ96_02435) comGE 466853..467167 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  LAZ96_RS02440 (LAZ96_02440) comGD 467151..467588 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  LAZ96_RS02445 (LAZ96_02445) comGC 467578..467886 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  LAZ96_RS02450 (LAZ96_02450) comGB 467891..468928 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  LAZ96_RS02455 (LAZ96_02455) comGA 468915..469985 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  LAZ96_RS02460 (LAZ96_02460) - 470178..471128 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=607380 LAZ96_RS02435 WP_017418140.1 466853..467167(-) (comGE) [Bacillus velezensis strain DMB05]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=607380 LAZ96_RS02435 WP_017418140.1 466853..467167(-) (comGE) [Bacillus velezensis strain DMB05]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481